DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl3

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001094038.1 Gene:Fbxl3 / 306129 RGDID:1305660 Length:428 Species:Rattus norvegicus


Alignment Length:184 Identity:38/184 - (20%)
Similarity:66/184 - (35%) Gaps:60/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 W-HIYRDLVL----ACPLLVMVEIS-ICSLNRDEYRLGEL-------------RYLQSL------ 258
            | ::.:|:||    ..|||.....| :|......:.:.:|             .||::.      
  Rat    36 WGNLLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK 100

  Fly   259 -VIKAHS------------------------TDTIRCKVSDWMLISLLDVPFLRNLMFSDAP-SG 297
             :||.||                        :..:.|.:....|||.....|:      |.| |.
  Rat   101 QIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFM------DLPKSH 159

  Fly   298 FVSANALSIISRFRQLRVLKMPNQPYRPNDL--LRLRNLTFLETLDLSNSPYIT 349
            |:||..:..::. :.|..||:.:.|.....|  |...|...|:.|.:|:.|:::
  Rat   160 FISALTVVFVNS-KSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381 4/16 (25%)
leucine-rich repeat 232..285 CDD:275381 14/97 (14%)
leucine-rich repeat 286..326 CDD:275381 10/40 (25%)
AMN1 306..>376 CDD:187754 11/46 (24%)
leucine-rich repeat 337..362 CDD:275381 4/13 (31%)
Fbxl3NP_001094038.1 F-box-like 36..77 CDD:403981 10/40 (25%)
leucine-rich repeat 174..199 CDD:275381 7/24 (29%)
leucine-rich repeat 200..225 CDD:275381 4/13 (31%)
leucine-rich repeat 252..286 CDD:275381
leucine-rich repeat 287..333 CDD:275381
leucine-rich repeat 334..360 CDD:275381
leucine-rich repeat 361..383 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.