DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15056 and Fbxl5

DIOPT Version :9

Sequence 1:	NP_573291.1	Gene:	CG15056 / 32824	FlyBaseID:	FBgn0030918	Length:	399	Species:	Drosophila melanogaster
Sequence 2:	XP_006251138.1	Gene:	Fbxl5 / 305424	RGDID:	1306887	Length:	690	Species:	Rattus norvegicus

Alignment Length:	98	Identity:	30/98 - (30%)
Similarity:	39/98 - (39%)	Gaps:	33/98 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   161 DLRY-----NDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFL---NRIPRLRELRASDLMP-- 215
            ||.|     :|:.||..       ||.|.::||..:..:.|..|   ..:|.|..|..|..:.
  Rat   582 DLIYFGSEKSDQETGRV-------LLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTVT 639

  Fly   216 -GGHWHIYRDLVLACPLLVMVEISICSLNRDEY 247
             .|    .:|||.|||          ||| |||
  Rat   640 GAG----LQDLVSACP----------SLN-DEY 657

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15056	NP_573291.1	leucine-rich repeat	133..156	CDD:275381
		leucine-rich repeat	157..179	CDD:275381	6/22 (27%)
		leucine-rich repeat	180..204	CDD:275381	7/26 (27%)
		leucine-rich repeat	205..231	CDD:275381	9/28 (32%)
		leucine-rich repeat	232..285	CDD:275381	6/16 (38%)
		leucine-rich repeat	286..326	CDD:275381
		AMN1	306..>376	CDD:187754
		leucine-rich repeat	337..362	CDD:275381
Fbxl5	XP_006251138.1	Hr_FBXL5	7..160	CDD:213984
		F-box-like	205..249	CDD:289689
		leucine-rich repeat	332..345	CDD:275381
		AMN1	<340..>404	CDD:187754
		leucine-rich repeat	358..384	CDD:275381
		leucine-rich repeat	385..448	CDD:275381
		leucine-rich repeat	449..516	CDD:275381
		leucine-rich repeat	540..571	CDD:275381
		leucine-rich repeat	573..626	CDD:275381	13/50 (26%)
		AMN1	<602..>653	CDD:187754	16/64 (25%)
		leucine-rich repeat	627..652	CDD:275381	10/38 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166346654
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1282076at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940