DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl5

DIOPT Version :10

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001388361.1 Gene:Fbxl5 / 305424 RGDID:1306887 Length:690 Species:Rattus norvegicus


Alignment Length:98 Identity:30/98 - (30%)
Similarity:39/98 - (39%) Gaps:33/98 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DLRY-----NDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFL---NRIPRLRELRASDLMP-- 215
            ||.|     :|:.||..       ||.|.::||..:..:.|..|   ..:|.|..|..|..:.  
  Rat   582 DLIYFGSEKSDQETGRV-------LLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTVT 639

  Fly   216 -GGHWHIYRDLVLACPLLVMVEISICSLNRDEY 247
             .|    .:|||.|||          ||| |||
  Rat   640 GAG----LQDLVSACP----------SL
N-DEY 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381 6/22 (27%)
leucine-rich repeat 180..204 CDD:275381 7/26 (27%)
leucine-rich repeat 205..231 CDD:275381 9/28 (32%)
leucine-rich repeat 232..285 CDD:275381 6/16 (38%)
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
Fbxl5NP_001388361.1 Hr_FBXL5 7..160 CDD:213984
F-box_FBXL5 205..245 CDD:438890
leucine-rich repeat 332..345 CDD:275381
AMN1 <340..>404 CDD:187754
leucine-rich repeat 358..384 CDD:275381
leucine-rich repeat 385..448 CDD:275381
leucine-rich repeat 449..516 CDD:275381
leucine-rich repeat 540..571 CDD:275381
leucine-rich repeat 573..626 CDD:275381 13/50 (26%)
AMN1 <602..>653 CDD:187754 16/64 (25%)
leucine-rich repeat 627..652 CDD:275381 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.