DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Kdm2b

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_038945396.1 Gene:Kdm2b / 304495 RGDID:1310217 Length:1350 Species:Rattus norvegicus


Alignment Length:268 Identity:63/268 - (23%)
Similarity:99/268 - (36%) Gaps:107/268 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 FSNLTY----VSLRRCQ-----LNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSL----PTSL- 180
            ||.|::    |.:|.|:     ..|:.|  |      ..:||.:...:|...|..:    |.|| 
  Rat  1088 FSYLSHQDLCVCMRVCRTWNRWCCDKRL--W------TRIDLNHCKSITPLMLSGIIRRQPVSLD 1144

  Fly   181 LSLYITGCRNLCPNQLIFL-NRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEIS-ICSLN 243
            ||     ..|:...||.:| ||:|.||:|    ::.|..|               :.:| :||  
  Rat  1145 LS-----WTNISKKQLSWLINRLPGLRDL----VLSGCSW---------------IAVSALCS-- 1183

  Fly   244 RDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIIS 308
                                         |...|:..|||.::..|  .||              
  Rat  1184 -----------------------------SSCPLLRTLDVQWVEGL--KDA-------------- 1203

  Fly   309 RFRQLRVLKMP---NQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVI-GIPNLSVLIVQ 369
               |:|.|..|   |:|.:.::..:|||:..|....|.    || :|.:.|:| .:|.||.|.:.
  Rat  1204 ---QMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLD----IT-DVSLRLIIRHMPLLSKLHLS 1260

  Fly   370 GCPLLTNR 377
            .|..:|::
  Rat  1261 YCNHVTDQ 1268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/31 (23%)
leucine-rich repeat 157..179 CDD:275381 5/25 (20%)
leucine-rich repeat 180..204 CDD:275381 9/25 (36%)
leucine-rich repeat 205..231 CDD:275381 5/25 (20%)
leucine-rich repeat 232..285 CDD:275381 8/53 (15%)
leucine-rich repeat 286..326 CDD:275381 9/42 (21%)
AMN1 306..>376 CDD:187754 21/73 (29%)
leucine-rich repeat 337..362 CDD:275381 7/25 (28%)
Kdm2bXP_038945396.1 JmjC 151..226 CDD:214721
cupin_RmlC-like 198..304 CDD:424065
JHD 303..>338 CDD:407680
CTD_KDM2B 476..584 CDD:412026
zf-CXXC <626..662 CDD:366873
PHD_KDM2B 672..733 CDD:277114
PTZ00449 <731..967 CDD:185628
F-box-like 1082..1120 CDD:403981 9/39 (23%)
leucine-rich repeat 1116..1140 CDD:275381 5/29 (17%)
AMN1 1132..1321 CDD:187754 51/216 (24%)
leucine-rich repeat 1141..1164 CDD:275381 10/27 (37%)
leucine-rich repeat 1165..1188 CDD:275381 9/72 (13%)
leucine-rich repeat 1189..1228 CDD:275381 13/57 (23%)
leucine-rich repeat 1229..1253 CDD:275381 7/28 (25%)
leucine-rich repeat 1254..1283 CDD:275381 5/15 (33%)
leucine-rich repeat 1284..1308 CDD:275381
leucine-rich repeat 1309..1333 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.