Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038945396.1 | Gene: | Kdm2b / 304495 | RGDID: | 1310217 | Length: | 1350 | Species: | Rattus norvegicus |
Alignment Length: | 268 | Identity: | 63/268 - (23%) |
---|---|---|---|
Similarity: | 99/268 - (36%) | Gaps: | 107/268 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 130 FSNLTY----VSLRRCQ-----LNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSL----PTSL- 180
Fly 181 LSLYITGCRNLCPNQLIFL-NRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEIS-ICSLN 243
Fly 244 RDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIIS 308
Fly 309 RFRQLRVLKMP---NQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVI-GIPNLSVLIVQ 369
Fly 370 GCPLLTNR 377 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | 7/31 (23%) |
leucine-rich repeat | 157..179 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 180..204 | CDD:275381 | 9/25 (36%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | 8/53 (15%) | ||
leucine-rich repeat | 286..326 | CDD:275381 | 9/42 (21%) | ||
AMN1 | 306..>376 | CDD:187754 | 21/73 (29%) | ||
leucine-rich repeat | 337..362 | CDD:275381 | 7/25 (28%) | ||
Kdm2b | XP_038945396.1 | JmjC | 151..226 | CDD:214721 | |
cupin_RmlC-like | 198..304 | CDD:424065 | |||
JHD | 303..>338 | CDD:407680 | |||
CTD_KDM2B | 476..584 | CDD:412026 | |||
zf-CXXC | <626..662 | CDD:366873 | |||
PHD_KDM2B | 672..733 | CDD:277114 | |||
PTZ00449 | <731..967 | CDD:185628 | |||
F-box-like | 1082..1120 | CDD:403981 | 9/39 (23%) | ||
leucine-rich repeat | 1116..1140 | CDD:275381 | 5/29 (17%) | ||
AMN1 | 1132..1321 | CDD:187754 | 51/216 (24%) | ||
leucine-rich repeat | 1141..1164 | CDD:275381 | 10/27 (37%) | ||
leucine-rich repeat | 1165..1188 | CDD:275381 | 9/72 (13%) | ||
leucine-rich repeat | 1189..1228 | CDD:275381 | 13/57 (23%) | ||
leucine-rich repeat | 1229..1253 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 1254..1283 | CDD:275381 | 5/15 (33%) | ||
leucine-rich repeat | 1284..1308 | CDD:275381 | |||
leucine-rich repeat | 1309..1333 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |