DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxo39

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001034107.1 Gene:Fbxo39 / 303287 RGDID:1311464 Length:443 Species:Rattus norvegicus


Alignment Length:327 Identity:63/327 - (19%)
Similarity:102/327 - (31%) Gaps:134/327 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFISFSVISRFDFFWLDVLKQLD---LK-SRISFAASCDMFENI-YVRSSPLRLSRVVNLEEMIE 61
            |.|..|:|....||...:.|.||   || :|::....|.:..:: |:|:.  .::..:|:|:   
  Rat   143 NSIRGSLIKSLSFFLKKMGKHLDHLSLKGARLTVEQGCHILNSLSYMRNE--NVASELNIED--- 202

  Fly    62 FSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAP 126
                                       .|||                .:|:.|     ...||..
  Rat   203 ---------------------------FFSH----------------HLAVYG-----SSQFNKA 219

  Fly   127 ETSFSNLTYVSLRRCQLNDENL------------------------------VGWEFLTHLETLD 161
            ..:|.|||:::|....::||.|                              :.|..|.. :..:
  Rat   220 MATFHNLTFLTLNYNCISDELLETLSENNAGTLRTMNIKCHVHDPHGQVVWGMSWAKLAR-QASN 283

  Fly   162 LRYN---------DRLTGSCLMSLPT---SLLSLYITG--------CRNLCPNQLIFLNRIPRLR 206
            |:.|         :||....|..:|.   ||.|.|.:.        ..:|.|.   |.|.:.:|.
  Rat   284 LKVNFFFERVMKYERLARILLQEIPVRSISLRSCYFSDPDWSMRPTLTDLLPT---FRNTLQKLT 345

  Fly   207 -ELRASDLMPGGHWHIYRDLVLACPLLVMVEI------------------SICSLNRDEYRLGEL 252
             |...:........|:   |:|||..|...:|                  ..|||...:.|:...
  Rat   346 FEFNNNHESLDEQLHL---LILACRKLFYFKIWAFLDVKFVERILKSQEEGQCSLRTLKVRIYTN 407

  Fly   253 RY 254
            ||
  Rat   408 RY 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/52 (15%)
leucine-rich repeat 157..179 CDD:275381 6/33 (18%)
leucine-rich repeat 180..204 CDD:275381 7/31 (23%)
leucine-rich repeat 205..231 CDD:275381 7/26 (27%)
leucine-rich repeat 232..285 CDD:275381 8/41 (20%)
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
Fbxo39NP_001034107.1 F-box-like 16..57 CDD:403981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.