DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Skp2

DIOPT Version :10

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001099886.1 Gene:Skp2 / 294790 RGDID:1562456 Length:423 Species:Rattus norvegicus


Alignment Length:207 Identity:46/207 - (22%)
Similarity:85/207 - (41%) Gaps:52/207 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TKVNEIALEGFQLTQYKWFNAPETSF----SNLTYVSLRRCQLNDENLVG--WEFLTHLETLDLR 163
            :|:..::|||.||:.      |..:.    .||..::|..|....|:.|.  ....:.|:.|:|.
  Rat   206 SKLQNLSLEGLQLSD------PIVTTLAQNENLVRLNLCGCSGFSESAVATLLSSCSRLDELNLS 264

  Fly   164 ----YNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRD 224
                :.::...:.:..||.:|..|.::|.|                :.|:.:||.         .
  Rat   265 WCFDFTEKHVQAAVAHLPDTLTQLNLSGYR----------------KNLQKTDLC---------T 304

  Fly   225 LVLACPLLVMVEISICSLNRDEY--RLGELRYLQSLVIKAHSTDTIRC-KVSDWMLISLLDVPFL 286
            |:..||.||.:::|...:.:::.  ...:|.|||.|.:.       || .:....|:.|.::|.|
  Rat   305 LIKRCPNLVRLDLSDSIMLKNDCFPEFFQLNYLQHLSLS-------RCYDIIPETLLELGEIPTL 362

  Fly   287 RNL-MFSDAPSG 297
            :.| :|...|.|
  Rat   363 KTLQVFGIVPDG 374

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..179 CDD:275381 5/25 (20%)
leucine-rich repeat 180..204 CDD:275381 4/23 (17%)
leucine-rich repeat 205..231 CDD:275381 5/25 (20%)
leucine-rich repeat 232..285 CDD:275381 12/55 (22%)
leucine-rich repeat 286..326 CDD:275381 5/13 (38%)
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
Skp2NP_001099886.1 F-box_FBXL1 97..137 CDD:438886
leucine-rich repeat 137..167 CDD:275381