DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL22

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_011519770.1 Gene:FBXL22 / 283807 HGNCID:27537 Length:260 Species:Homo sapiens


Alignment Length:103 Identity:25/103 - (24%)
Similarity:40/103 - (38%) Gaps:28/103 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 NLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEV 352
            |...|..||.|.|..                |:.|..||          |.::.||...::|::.
Human   128 NPAVSSQPSVFTSQG----------------PSPPRCPN----------LASVTLSGCGHVTDDC 166

  Fly   353 VIELVIGIPNLSVLIVQGCPLLTNRVYLDAELASKKRS 390
            :..|:...|.|..|.::.|..:|||..  |.:|:..|:
Human   167 LARLLRCCPRLRALRLENCARVTNRTL--AAVAADGRA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381
leucine-rich repeat 232..285 CDD:275381
leucine-rich repeat 286..326 CDD:275381 8/37 (22%)
AMN1 306..>376 CDD:187754 13/69 (19%)
leucine-rich repeat 337..362 CDD:275381 5/24 (21%)
FBXL22XP_011519770.1 AMN1 <148..229 CDD:187754 17/67 (25%)
leucine-rich repeat 151..176 CDD:275381 5/24 (21%)
leucine-rich repeat 177..202 CDD:275381 8/26 (31%)
leucine-rich repeat 203..228 CDD:275381 25/103 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153002
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.