DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl4

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_766576.1 Gene:Fbxl4 / 269514 MGIID:2140367 Length:621 Species:Mus musculus


Alignment Length:414 Identity:87/414 - (21%)
Similarity:132/414 - (31%) Gaps:165/414 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 MIEFSLLETKLFVELSGSDIEIIR---------GGPHTPMFSHFE-DFIRLMSIRLTKVNEIALE 113
            :::.:.||...:.|..|.:::.:.         .|||...|.... :.|:|:      :|.::|.
Mouse   240 LVDMNDLEDDDYEEKDGCEMDALNKKFSSAALGDGPHNGYFDKLPYELIQLI------LNHLSLP 298

  Fly   114 G-----------------------FQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGW---- 151
            .                       ..|..| |....:||...|.    .||.|.....:.|    
Mouse   299 DLCRLAQTCRLLHQHCCDPLQYIHLNLQPY-WARLDDTSLEFLQ----ARCVLVQWLNLSWTGNR 358

  Fly   152 ---------EFL----THLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNRIP 203
                     .||    :.|..|:|..:..|..:||     .::|       .:|||         
Mouse   359 GFISVSGFSRFLKVCGSELVRLELSCSHFLNDTCL-----EVIS-------EMCPN--------- 402

  Fly   204 RLRELRASD---LMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHST 265
             |::|..|.   |.|....||.:               :|||.|             ||:     
Mouse   403 -LQDLNLSSCDKLPPQAFGHIAK---------------LCSLKR-------------LVL----- 433

  Fly   266 DTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSAN----ALSIISRFRQLRVLKMPNQPYRPN 326
              .|.||....|:|:|:  |...|......|..:..:    |..|.::.:.||.|          
Mouse   434 --YRTKVEQTALLSILN--FCAELQHLSLGSCVMIEDYDVIASMIGAKCKNLRTL---------- 484

  Fly   327 DLLRLRNLT------------FLETLDLSNSPYITNEV--VIELVIGIPNLSVLIVQGCPLLTNR 377
            ||.|.:|:|            .||.|||...|.:.:..  .:.|...:|||..|.     |..||
Mouse   485 DLWRCKNITENGIAELASGCVLLEELDLGWCPTLQSSTGCFVRLARQLPNLQKLF-----LTANR 544

  Fly   378 VYLDA---ELASKKRSNGNMVKVQ 398
            ...|.   ||||      |..::|
Mouse   545 SVCDTDIEELAS------NCTRLQ 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/39 (18%)
leucine-rich repeat 157..179 CDD:275381 6/21 (29%)
leucine-rich repeat 180..204 CDD:275381 4/23 (17%)
leucine-rich repeat 205..231 CDD:275381 7/28 (25%)
leucine-rich repeat 232..285 CDD:275381 12/52 (23%)
leucine-rich repeat 286..326 CDD:275381 7/43 (16%)
AMN1 306..>376 CDD:187754 21/83 (25%)
leucine-rich repeat 337..362 CDD:275381 7/26 (27%)
Fbxl4NP_766576.1 F-box-like 280..318 CDD:372399 5/43 (12%)
leucine-rich repeat 295..317 CDD:275381 1/21 (5%)
leucine-rich repeat 318..340 CDD:275381 5/22 (23%)
leucine-rich repeat 347..376 CDD:275381 3/28 (11%)
LRR 1 376..397 6/25 (24%)
leucine-rich repeat 377..402 CDD:275381 8/36 (22%)
AMN1 394..601 CDD:187754 57/244 (23%)
LRR 2 402..421 6/28 (21%)
leucine-rich repeat 403..427 CDD:275381 7/38 (18%)
LRR 3 427..448 10/40 (25%)
leucine-rich repeat 428..452 CDD:275381 11/45 (24%)
LRR 4 452..474 3/21 (14%)
leucine-rich repeat 453..480 CDD:275381 4/26 (15%)
LRR 5 480..501 8/30 (27%)
leucine-rich repeat 481..506 CDD:275381 8/34 (24%)
LRR 6 504..524 6/19 (32%)
leucine-rich repeat 507..534 CDD:275381 7/26 (27%)
LRR 7 532..558 12/36 (33%)
leucine-rich repeat 535..560 CDD:275381 11/35 (31%)
LRR 8 559..583 1/4 (25%)
leucine-rich repeat 561..586 CDD:275381 1/2 (50%)
LRR 9 584..609
leucine-rich repeat 587..612 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.