DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL4

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001265645.1 Gene:FBXL4 / 26235 HGNCID:13601 Length:621 Species:Homo sapiens


Alignment Length:426 Identity:87/426 - (20%)
Similarity:156/426 - (36%) Gaps:121/426 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VRSSPLRLSRVVNLE-EMIEFSLLETKLFVELSGSDIE---------IIRGGPHTPMFSHFE-DF 96
            |:..|     |::|: .:|:.:.:|...:.|..|..::         ::..||:...|.... :.
Human   228 VKDKP-----VLSLKTSLIDMNDIEDDAYAEKDGCGMDSLNKKFSSAVLGEGPNNGYFDKLPYEL 287

  Fly    97 IRLMSIRLT----------------------------------KVNEIALEGFQ--LTQYKWFNA 125
            |:|:...||                                  |:::.:||..|  .|..:|.|.
Human   288 IQLILNHLTLPDLCRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQWLNL 352

  Fly   126 PETSFSNLTYVSLRRCQLNDENLVGW-EFL----THLETLDLRYNDRLTGSCL---MSLPTSLLS 182
            ..|  .|..::|          :.|: .||    :.|..|:|..:..|..:||   ..:..:|.:
Human   353 SWT--GNRGFIS----------VAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQA 405

  Fly   183 LYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEY 247
            |.::.|..|.|..   .|.|.:|..|:...|        ||..|....||.:  ::.||      
Human   406 LNLSSCDKLPPQA---FNHIAKLCSLKRLVL--------YRTKVEQTALLSI--LNFCS------ 451

  Fly   248 RLGELRYLQ--SLVI----------------KAHSTDTIRCK-VSDWMLISLLD-VPFLRNLMFS 292
               ||::|.  |.|:                |..:.|..||| :::..:..|.. .|.|..|...
Human   452 ---ELQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDLG 513

  Fly   293 DAPSGFVSANALSIISRFRQL----RVLKMPNQPYRPNDLLRLR-NLTFLETLDLSNSPYITNEV 352
            ..|:...|....:.::  .||    ::....|:.....|:..|. |.|.|:.||:..:..::...
Human   514 WCPTLQSSTGCFTRLA--HQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPAS 576

  Fly   353 VIELVIGIPNLSVLIVQGCPLLTNRVYLDAELASKK 388
            :.:|:....:||:|.|..|..:.||..|:...:..|
Human   577 LRKLLESCKDLSLLDVSFCSQIDNRAVLELNASFPK 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/27 (15%)
leucine-rich repeat 157..179 CDD:275381 6/24 (25%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 14/72 (19%)
leucine-rich repeat 286..326 CDD:275381 7/43 (16%)
AMN1 306..>376 CDD:187754 16/74 (22%)
leucine-rich repeat 337..362 CDD:275381 4/24 (17%)
FBXL4NP_001265645.1 F-box-like 280..318 CDD:315592 5/37 (14%)
leucine-rich repeat 295..317 CDD:275381 2/21 (10%)
leucine-rich repeat 318..346 CDD:275381 4/27 (15%)
leucine-rich repeat 347..376 CDD:275381 8/40 (20%)
LRR 1 376..397 6/20 (30%)
leucine-rich repeat 377..398 CDD:275381 6/20 (30%)
AMN1 394..601 CDD:332986 49/230 (21%)
LRR 2 402..421 5/21 (24%)
leucine-rich repeat 403..427 CDD:275381 8/26 (31%)
LRR 3 427..448 7/30 (23%)
leucine-rich repeat 428..452 CDD:275381 9/42 (21%)
LRR 4 452..474 5/21 (24%)
leucine-rich repeat 453..480 CDD:275381 4/26 (15%)
LRR 5 480..501 5/20 (25%)
leucine-rich repeat 481..506 CDD:275381 5/24 (21%)
LRR 6 504..524 5/19 (26%)
leucine-rich repeat 507..534 CDD:275381 6/28 (21%)
LRR 7 532..558 4/25 (16%)
leucine-rich repeat 535..560 CDD:275381 4/24 (17%)
LRR 8 559..583 5/23 (22%)
leucine-rich repeat 561..586 CDD:275381 4/24 (17%)
LRR 9 584..609 8/24 (33%)
leucine-rich repeat 587..612 CDD:275381 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.