DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL3

DIOPT Version :10

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_036290.1 Gene:FBXL3 / 26224 HGNCID:13599 Length:428 Species:Homo sapiens


Alignment Length:184 Identity:37/184 - (20%)
Similarity:66/184 - (35%) Gaps:60/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 W-HIYRDLVLA----CPLLVMVEIS-ICSLNRDEYRLGEL-------------RYLQSL------ 258
            | ::.:|::|.    .|||.....| :|......:.:.:|             .||::.      
Human    36 WGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLW
RCFEFELNQPATSYLKATHPELIK 100

  Fly   259 -VIKAHS------------------------TDTIRCKVSDWMLISLLDVPFLRNLMFSDAP-SG 297
             :||.||                        :..:.|.:....|||.....|:      |.| |.
Human   101 QIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFM------DLPKSH 159

  Fly   298 FVSANALSIISRFRQLRVLKMPNQPYRPNDL--LRLRNLTFLETLDLSNSPYIT 349
            |:||..:..::. :.|..||:.:.|.....|  |...|...|:.|.:|:.|:::
Human   160 FISALTVVFVNS-KSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381 3/16 (19%)
leucine-rich repeat 232..285 CDD:275381 14/97 (14%)
leucine-rich repeat 286..326 CDD:275381 10/40 (25%)
AMN1 306..>376 CDD:187754 11/46 (24%)
leucine-rich repeat 337..362 CDD:275381 4/13 (31%)
FBXL3NP_036290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
F-box_FBXL3 34..76 CDD:438949 8/39 (21%)
FBXL3_LRR 79..428 CDD:467832 28/141 (20%)
LRR 1 119..146 2/26 (8%)
leucine-rich repeat 174..199 CDD:275381 7/24 (29%)
LRR 2 181..207 6/25 (24%)
leucine-rich repeat 200..225 CDD:275381 4/13 (31%)
LRR 3 208..233 1/5 (20%)
LRR 4 234..259
leucine-rich repeat 252..286 CDD:275381
leucine-rich repeat 287..333 CDD:275381
LRR 5 316..341
leucine-rich repeat 334..360 CDD:275381
LRR 6 343..368
leucine-rich repeat 361..383 CDD:275381
LRR 7 369..394
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.