DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL2

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001336245.1 Gene:FBXL2 / 25827 HGNCID:13598 Length:454 Species:Homo sapiens


Alignment Length:390 Identity:87/390 - (22%)
Similarity:146/390 - (37%) Gaps:115/390 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKQLDLKSRI--------SFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSL---------LET 67
            |::|.|:..|        :||.:|...|:       |.|:....:.:...:||         |:.
Human    80 LRKLSLRGCIGVGDSSLKTFAQNCRNIEH-------LNLNGCTKITDSTCYSLSRFCSKLKHLDL 137

  Fly    68 KLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSN 132
            ...|.::.|.::.|..|..           .|..:.|:..::|..:|.:        |.......
Human   138 TSCVSITNSSLKGISEGCR-----------NLEYLNLSWCDQITKDGIE--------ALVRGCRG 183

  Fly   133 LTYVSLRRC-QLNDENLVGWEFLTH-LETLDLRYNDRLTGSCLMSLPTS---LLSLYITGCRNLC 192
            |..:.||.| ||.||.|...:...| |.:|:|:...|:|...::.:...   |.:|.::||.||.
Human   184 LKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLT 248

  Fly   193 PNQLIFLN-RIPRLREL---RASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELR 253
            ...|..|. ..|||:.|   |.|.|...|...:.|:    |..|..:::..|.|           
Human   249 DASLTALGLNCPRLQILEAARCSHLTDAGFTLLARN----CHELEKMDLEECIL----------- 298

  Fly   254 YLQSLVIKAHSTDTIRCKVSDWMLISL-LDVPFLR---NLMFSDAPSGFVSANALSIISRFRQLR 314
                              ::|..||.| :..|.|:   :|.|||.                  :.
Human   299 ------------------ITDSTLIQLSIHCPKLQALVSLSFSDI------------------IH 327

  Fly   315 VLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIEL---VIGIPNLSVLIVQGCPLLTN 376
            :||| .:|...|.  :|...:|.::  ||:...||::.::.|   ..|...|.||.:..|.|:|:
Human   328 LLKM-KEPSHHNK--KLFGFSFCKS--LSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITD 387

  Fly   377  376
            Human   388  387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 9/23 (39%)
leucine-rich repeat 157..179 CDD:275381 5/21 (24%)
leucine-rich repeat 180..204 CDD:275381 8/24 (33%)
leucine-rich repeat 205..231 CDD:275381 8/28 (29%)
leucine-rich repeat 232..285 CDD:275381 7/53 (13%)
leucine-rich repeat 286..326 CDD:275381 9/42 (21%)
AMN1 306..>376 CDD:187754 18/72 (25%)
leucine-rich repeat 337..362 CDD:275381 6/27 (22%)
FBXL2NP_001336245.1 F-box-like 15..56 CDD:315592
leucine-rich repeat 52..79 CDD:275381
AMN1 <76..223 CDD:332986 36/168 (21%)
leucine-rich repeat 80..99 CDD:275381 4/18 (22%)
leucine-rich repeat 106..131 CDD:275381 5/31 (16%)
leucine-rich repeat 132..157 CDD:275381 5/35 (14%)
leucine-rich repeat 158..183 CDD:275381 5/32 (16%)
AMN1 168..398 CDD:332986 68/284 (24%)
leucine-rich repeat 184..209 CDD:275381 9/24 (38%)
leucine-rich repeat 210..235 CDD:275381 5/24 (21%)
leucine-rich repeat 236..261 CDD:275381 8/24 (33%)
leucine-rich repeat 262..287 CDD:275381 8/28 (29%)
leucine-rich repeat 288..313 CDD:275381 7/53 (13%)
leucine-rich repeat 314..364 CDD:275381 16/72 (22%)
leucine-rich repeat 374..393 CDD:275381 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.