DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl19

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_036008913.1 Gene:Fbxl19 / 233902 MGIID:3039600 Length:696 Species:Mus musculus


Alignment Length:228 Identity:53/228 - (23%)
Similarity:79/228 - (34%) Gaps:83/228 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISFSVISRFDFFW----LDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSL 64
            :|::.:|:....|    |..|::|.|       :.|.......:.|:||...|           |
Mouse   492 LSWTGVSKKQLMWLLNRLQGLQELVL-------SGCSWLSVSALGSAPLPALR-----------L 538

  Fly    65 LETKLFVELSGSDI-EIIRGGPHT-PMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPE 127
            |:.:...::..|.: |::...|.| |..:....       ||..|.|:.|.|.:||.        
Mouse   539 LDLRWIEDVKDSQLRELLLPPPDTKPGQTESRG-------RLQGVAELRLAGLELTD-------- 588

  Fly   128 TSFSNLTYVSLRRCQLNDENLVGWEFLTH---LETLDLRYNDRLTGSC---------LMSLPTS- 179
                    .|||.            .|.|   |..|||.:       |         |::.||| 
Mouse   589 --------ASLRL------------LLRHAPQLSALDLSH-------CAHVGDPSVHLLTAPTSP 626

  Fly   180 ----LLSLYITGCRNLCPNQLIFLNRIPRLREL 208
                |:.|.:.||..|..:.|....|.||||.|
Mouse   627 LRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRL 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/22 (18%)
leucine-rich repeat 157..179 CDD:275381 7/30 (23%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 3/4 (75%)
leucine-rich repeat 232..285 CDD:275381
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
Fbxl19XP_036008913.1 zf-CXXC <52..79 CDD:366873
PHD_FXL19 89..150 CDD:277115
F-box-like 426..467 CDD:403981
AMN1 468..667 CDD:187754 53/228 (23%)
leucine-rich repeat 488..511 CDD:275381 4/18 (22%)
leucine-rich repeat 512..535 CDD:275381 7/29 (24%)
leucine-rich repeat 573..600 CDD:275381 12/54 (22%)
leucine-rich repeat 601..627 CDD:275381 9/32 (28%)
leucine-rich repeat 631..655 CDD:275381 7/23 (30%)
leucine-rich repeat 656..680 CDD:275381 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.