Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036008913.1 | Gene: | Fbxl19 / 233902 | MGIID: | 3039600 | Length: | 696 | Species: | Mus musculus |
Alignment Length: | 228 | Identity: | 53/228 - (23%) |
---|---|---|---|
Similarity: | 79/228 - (34%) | Gaps: | 83/228 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 ISFSVISRFDFFW----LDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSL 64
Fly 65 LETKLFVELSGSDI-EIIRGGPHT-PMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPE 127
Fly 128 TSFSNLTYVSLRRCQLNDENLVGWEFLTH---LETLDLRYNDRLTGSC---------LMSLPTS- 179
Fly 180 ----LLSLYITGCRNLCPNQLIFLNRIPRLREL 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | 4/22 (18%) |
leucine-rich repeat | 157..179 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 180..204 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 3/4 (75%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | |||
leucine-rich repeat | 286..326 | CDD:275381 | |||
AMN1 | 306..>376 | CDD:187754 | |||
leucine-rich repeat | 337..362 | CDD:275381 | |||
Fbxl19 | XP_036008913.1 | zf-CXXC | <52..79 | CDD:366873 | |
PHD_FXL19 | 89..150 | CDD:277115 | |||
F-box-like | 426..467 | CDD:403981 | |||
AMN1 | 468..667 | CDD:187754 | 53/228 (23%) | ||
leucine-rich repeat | 488..511 | CDD:275381 | 4/18 (22%) | ||
leucine-rich repeat | 512..535 | CDD:275381 | 7/29 (24%) | ||
leucine-rich repeat | 573..600 | CDD:275381 | 12/54 (22%) | ||
leucine-rich repeat | 601..627 | CDD:275381 | 9/32 (28%) | ||
leucine-rich repeat | 631..655 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 656..680 | CDD:275381 | 3/4 (75%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167843173 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |