| Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036436.1 | Gene: | FBXL7 / 23194 | HGNCID: | 13604 | Length: | 491 | Species: | Homo sapiens |
| Alignment Length: | 291 | Identity: | 69/291 - (23%) |
|---|---|---|---|
| Similarity: | 111/291 - (38%) | Gaps: | 86/291 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 157 LETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNR-IPRLRELRASDLMPGGHWH 220
Fly 221 IYR----DLVLACPLLVMVEISIC------SLNRD-EYRLGEL-------RYLQSL--------- 258
Fly 259 --VIKAHSTDTI-----RC-KVSD----WMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFR 311
Fly 312 -QLRVLKMPNQPYRPNDL-----------LR------------------LRNLTFLETLDLSNSP 346
Fly 347 YITNEVVIELVIGIPNLSVLIVQGCPLLTNR 377 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | |
| leucine-rich repeat | 157..179 | CDD:275381 | 6/21 (29%) | ||
| leucine-rich repeat | 180..204 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 205..231 | CDD:275381 | 9/29 (31%) | ||
| leucine-rich repeat | 232..285 | CDD:275381 | 19/87 (22%) | ||
| leucine-rich repeat | 286..326 | CDD:275381 | 12/40 (30%) | ||
| AMN1 | 306..>376 | CDD:187754 | 19/99 (19%) | ||
| leucine-rich repeat | 337..362 | CDD:275381 | 5/24 (21%) | ||
| FBXL7 | NP_036436.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..79 | ||
| F-box-like | 114..157 | CDD:372399 | |||
| leucine-rich repeat | 129..151 | CDD:275381 | |||
| leucine-rich repeat | 154..187 | CDD:275381 | 4/16 (25%) | ||
| LRR 1 | 170..195 | 7/29 (24%) | |||
| AMN1 | <185..366 | CDD:187754 | 51/196 (26%) | ||
| leucine-rich repeat | 188..213 | CDD:275381 | 6/24 (25%) | ||
| LRR 2 | 196..221 | 9/29 (31%) | |||
| leucine-rich repeat | 214..234 | CDD:275381 | 7/24 (29%) | ||
| LRR 3 | 222..247 | 6/24 (25%) | |||
| leucine-rich repeat | 240..273 | CDD:275381 | 8/32 (25%) | ||
| LRR 4 | 253..281 | 8/27 (30%) | |||
| leucine-rich repeat | 274..299 | CDD:275381 | 6/24 (25%) | ||
| LRR 5 | 282..307 | 4/24 (17%) | |||
| AMN1 | 297..464 | CDD:187754 | 32/154 (21%) | ||
| leucine-rich repeat | 300..325 | CDD:275381 | 4/24 (17%) | ||
| LRR 6 | 308..333 | 4/27 (15%) | |||
| leucine-rich repeat | 326..351 | CDD:275381 | 8/29 (28%) | ||
| LRR 7 | 334..359 | 8/26 (31%) | |||
| leucine-rich repeat | 352..377 | CDD:275381 | 5/25 (20%) | ||
| LRR 8 | 360..385 | 4/25 (16%) | |||
| leucine-rich repeat | 378..403 | CDD:275381 | 3/24 (13%) | ||
| LRR 9 | 386..411 | 5/24 (21%) | |||
| leucine-rich repeat | 404..429 | CDD:275381 | 5/24 (21%) | ||
| LRR 10 | 412..437 | 5/24 (21%) | |||
| leucine-rich repeat | 430..453 | CDD:275381 | 4/15 (27%) | ||
| LRR 11 | 438..463 | 2/7 (29%) | |||
| leucine-rich repeat | 456..480 | CDD:275381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165153069 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.830 | |||||