DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and KDM2A

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_036440.1 Gene:KDM2A / 22992 HGNCID:13606 Length:1162 Species:Homo sapiens


Alignment Length:271 Identity:61/271 - (22%)
Similarity:100/271 - (36%) Gaps:82/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLS 182
            |.|||......    .|.:.|.||:......:.........:|||.:.                 
Human   919 TWYKWCCDKRL----WTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWT----------------- 962

  Fly   183 LYITGCRNLCPNQLIFL-NRIPRLRELRASDLMPGGHWHIYRDL-VLACPLLVMVEISICSLNRD 245
                   |:...||.:| ||:|.|::|    |:.|..|.....| ..:||||             
Human   963 -------NISKKQLTWLVNRLPGLKDL----LLAGCSWSAVSALSTSSCPLL------------- 1003

  Fly   246 EYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRF 310
              |..:||:...              :.|..:..||..|       :|.| |..:.:.|..::.|
Human  1004 --RTLDLRWAVG--------------IKDPQIRDLLTPP-------ADKP-GQDNRSKLRNMTDF 1044

  Fly   311 RQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVV-IELVIGIP---NLSVLIVQGC 371
            | |..|.:.:...|    |.:|::..|..||||:..::|::.. :...:|..   :|:.|.:.||
Human  1045 R-LAGLDITDATLR----LIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGC 1104

  Fly   372 PLLTNR--VYL 380
            ..||::  :||
Human  1105 NKLTDQTLIYL 1115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/22 (18%)
leucine-rich repeat 157..179 CDD:275381 3/21 (14%)
leucine-rich repeat 180..204 CDD:275381 6/24 (25%)
leucine-rich repeat 205..231 CDD:275381 7/26 (27%)
leucine-rich repeat 232..285 CDD:275381 7/52 (13%)
leucine-rich repeat 286..326 CDD:275381 9/39 (23%)
AMN1 306..>376 CDD:187754 19/73 (26%)
leucine-rich repeat 337..362 CDD:275381 7/28 (25%)
KDM2ANP_036440.1 cupin_like 199..299 CDD:328732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..389
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:251032
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 839..887
F-box-like 896..934 CDD:315592 5/18 (28%)
leucine-rich repeat 930..954 CDD:275381 4/23 (17%)
AMN1 932..1138 CDD:332986 56/254 (22%)
leucine-rich repeat 955..978 CDD:275381 9/46 (20%)
LRR 1 961..982 8/44 (18%)
leucine-rich repeat 979..1002 CDD:275381 7/26 (27%)
LRR 2 984..1010 9/40 (23%)
leucine-rich repeat 1003..1040 CDD:275381 12/73 (16%)
leucine-rich repeat 1041..1065 CDD:275381 7/28 (25%)
LRR 3 1048..1073 8/28 (29%)
leucine-rich repeat 1066..1095 CDD:275381 7/28 (25%)
LRR 4 1074..1103 4/28 (14%)
leucine-rich repeat 1096..1120 CDD:275381 8/20 (40%)
LRR 5 1104..1128 5/12 (42%)
leucine-rich repeat 1121..1140 CDD:275381
LRR 6 1129..1156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.