DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL13

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001381423.1 Gene:FBXL13 / 222235 HGNCID:21658 Length:825 Species:Homo sapiens


Alignment Length:375 Identity:78/375 - (20%)
Similarity:139/375 - (37%) Gaps:129/375 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FAASCDMFENIYVRS-SPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPMFS--H 92
            :.|.|....:..:|| |||:...|:||...:....:..|.|::           ||.:....  :
Human   522 YMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLD-----------GPASMRIRELN 575

  Fly    93 FEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGWEFLTHL 157
            ..:.:||....:.|::|              ..|     ||.|:|||.|:             ||
Human   576 LSNCVRLSDASVMKLSE--------------RCP-----NLNYLSLRNCE-------------HL 608

  Fly   158 ETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIY 222
            ....:.|        :::: .||:|:.::| .::....|..|:|..:|:||..|:.     :.|.
Human   609 TAQGIGY--------IVNI-FSLVSIDLSG-TDISNEGLNVLSRHKKLKELSVSEC-----YRIT 658

  Fly   223 RDLVLA-CP---LLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDV 283
            .|.:.| |.   :|..:::|.||            .|..::|||.:...|.              
Human   659 DDGIQAFCKSSLILEHLDVSYCS------------QLSDMIIKALAIYCIN-------------- 697

  Fly   284 PFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYI 348
              |.:|..:..|.  ::.:|:.::|                       ....:|..||:|....:
Human   698 --LTSLSIAGCPK--ITDSAMEMLS-----------------------AKCHYLHILDISGCVLL 735

  Fly   349 TNEVVIELVIGIPNLSVLIVQGCPLLTNRVYLDAELASKKRSNGNMVKVQ 398
            |::::.:|.||...|.:|.:|.|   ||        .|||.:.....|||
Human   736 TDQILEDLQIGCKQLRILKMQYC---TN--------ISKKAAQRMSSKVQ 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 6/22 (27%)
leucine-rich repeat 157..179 CDD:275381 2/21 (10%)
leucine-rich repeat 180..204 CDD:275381 6/23 (26%)
leucine-rich repeat 205..231 CDD:275381 8/29 (28%)
leucine-rich repeat 232..285 CDD:275381 9/52 (17%)
leucine-rich repeat 286..326 CDD:275381 5/39 (13%)
AMN1 306..>376 CDD:187754 13/69 (19%)
leucine-rich repeat 337..362 CDD:275381 8/24 (33%)
FBXL13NP_001381423.1 Sfi1 <112..>224 CDD:400658
F-box-like 245..289 CDD:403981
leucine-rich repeat 285..312 CDD:275381
AMN1 312..497 CDD:187754
leucine-rich repeat 313..336 CDD:275381
leucine-rich repeat 337..362 CDD:275381
leucine-rich repeat 363..387 CDD:275381
leucine-rich repeat 388..406 CDD:275381
leucine-rich repeat 416..441 CDD:275381
leucine-rich repeat 442..491 CDD:275381
leucine-rich repeat 468..490 CDD:275381
leucine-rich repeat 492..515 CDD:275381
leucine-rich repeat 518..542 CDD:275381 7/19 (37%)
AMN1 529..737 CDD:187754 60/318 (19%)
leucine-rich repeat 543..570 CDD:275381 7/37 (19%)
leucine-rich repeat 571..596 CDD:275381 5/43 (12%)
leucine-rich repeat 597..645 CDD:275381 16/70 (23%)
leucine-rich repeat 646..671 CDD:275381 8/29 (28%)
leucine-rich repeat 672..697 CDD:275381 8/36 (22%)
leucine-rich repeat 698..723 CDD:275381 5/49 (10%)
leucine-rich repeat 724..749 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.