DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl21

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001333661.1 Gene:Fbxl21 / 213311 MGIID:2442921 Length:460 Species:Mus musculus


Alignment Length:283 Identity:57/283 - (20%)
Similarity:100/283 - (35%) Gaps:93/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 RNLCPNQLIFLNRIPRLRELRA-SDLMPGG---HWHIYRDLVLACPLLVMVEI-SICSLNRDEYR 248
            |.||.:          ||:..| |.|:..|   | |:...:....||:..... |:|....:.:.
Mouse    50 RGLCSS----------LRQTHALSVLLDWGTLPH-HVILQIFQYLPLIDRARASSVCRRWNEVFH 103

  Fly   249 LGEL-------------RYLQSL-------VIKAH-------------STDT-----------IR 269
            :.:|             .|.:|.       :||.|             ||::           :.
Mouse   104 IPDLWRKFEFELNQSATSYFKSTHPDLIQQIIKKHAAHLQYVSFKVDSSTESAEAACDILSQLVN 168

  Fly   270 CKVSDWMLISLLDVPFLRNLMFSDAP-SGFVSANALSIISRFRQLRVLKMPNQPYRPNDL--LRL 331
            |.:....|||.....|:      :.| |.||||..:..::. :.|..:|:.:.|.....|  |..
Mouse   169 CSIQTLGLISTAKPSFM------NVPKSHFVSALTVVFVNS-KSLSSIKIEDTPVDDPSLKILVA 226

  Fly   332 RNLTFLETLDLSNSPYITNEVVI----------ELVIGIPNLS--VLIVQGCPLLTNRVYLDAEL 384
            .|...|..|.:|:.|:::::.::          ||.:....||  :|:........|..:|..::
Mouse   227 NNSDTLRLLKMSSCPHVSSDGILCVADHCQGLRELALNYYILSDEILLALSSETHVNLEHLRIDV 291

  Fly   385 AS-----------KKRSNGNMVK 396
            .|           ||||...::|
Mouse   292 VSENPGQIKFHSIKKRSWDALIK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381 3/14 (21%)
leucine-rich repeat 205..231 CDD:275381 8/29 (28%)
leucine-rich repeat 232..285 CDD:275381 14/97 (14%)
leucine-rich repeat 286..326 CDD:275381 9/40 (23%)
AMN1 306..>376 CDD:187754 15/83 (18%)
leucine-rich repeat 337..362 CDD:275381 6/34 (18%)
Fbxl21NP_001333661.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.