Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001333661.1 | Gene: | Fbxl21 / 213311 | MGIID: | 2442921 | Length: | 460 | Species: | Mus musculus |
Alignment Length: | 283 | Identity: | 57/283 - (20%) |
---|---|---|---|
Similarity: | 100/283 - (35%) | Gaps: | 93/283 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 RNLCPNQLIFLNRIPRLRELRA-SDLMPGG---HWHIYRDLVLACPLLVMVEI-SICSLNRDEYR 248
Fly 249 LGEL-------------RYLQSL-------VIKAH-------------STDT-----------IR 269
Fly 270 CKVSDWMLISLLDVPFLRNLMFSDAP-SGFVSANALSIISRFRQLRVLKMPNQPYRPNDL--LRL 331
Fly 332 RNLTFLETLDLSNSPYITNEVVI----------ELVIGIPNLS--VLIVQGCPLLTNRVYLDAEL 384
Fly 385 AS-----------KKRSNGNMVK 396 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | |
leucine-rich repeat | 157..179 | CDD:275381 | |||
leucine-rich repeat | 180..204 | CDD:275381 | 3/14 (21%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 8/29 (28%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | 14/97 (14%) | ||
leucine-rich repeat | 286..326 | CDD:275381 | 9/40 (23%) | ||
AMN1 | 306..>376 | CDD:187754 | 15/83 (18%) | ||
leucine-rich repeat | 337..362 | CDD:275381 | 6/34 (18%) | ||
Fbxl21 | NP_001333661.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167843153 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |