DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AMN1

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001106873.1 Gene:AMN1 / 196394 HGNCID:27281 Length:258 Species:Homo sapiens


Alignment Length:284 Identity:51/284 - (17%)
Similarity:99/284 - (34%) Gaps:97/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYND- 166
            ||.|:  ::::| |:|.   .|..|.....:..:.||.|.::|..|:.......|:.|:|..:. 
Human    39 RLIKI--MSMQG-QITD---SNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKG 97

  Fly   167 ---RLTGSCLMSLPTSLLSLY---ITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDL 225
               .:|...:.::.:|...|:   :..|.||....::                          .|
Human    98 NRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVV--------------------------AL 136

  Fly   226 VLACPLLVMVEISICSLNRDE--YRLGE-LRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLR 287
            .|.|.||.::::..|....|.  :.||: ..:||.:       |....:|||..:|:|:..|..:
Human   137 ALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCV-------DFSATQVSDSGVIALVSGPCAK 194

  Fly   288 NLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEV 352
            .                                                ||.:.:.:...:|:..
Human   195 K------------------------------------------------LEEIHMGHCVNLTDGA 211

  Fly   353 VIELVIGIPNLSVLIVQGCPLLTN 376
            |..::...|.:.:|:..||||:|:
Human   212 VEAVLTYCPQIRILLFHGCPLITD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/22 (23%)
leucine-rich repeat 157..179 CDD:275381 4/25 (16%)
leucine-rich repeat 180..204 CDD:275381 4/26 (15%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 13/55 (24%)
leucine-rich repeat 286..326 CDD:275381 0/39 (0%)
AMN1 306..>376 CDD:187754 10/69 (14%)
leucine-rich repeat 337..362 CDD:275381 4/24 (17%)
AMN1NP_001106873.1 AMN1 37..257 CDD:187754 51/284 (18%)
leucine-rich repeat 63..86 CDD:275381 5/22 (23%)
leucine-rich repeat 87..116 CDD:275381 5/28 (18%)
leucine-rich repeat 117..142 CDD:275381 7/50 (14%)
leucine-rich repeat 143..168 CDD:275381 5/24 (21%)
leucine-rich repeat 169..195 CDD:275381 9/32 (28%)
leucine-rich repeat 196..221 CDD:275381 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.