DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and B0564.9

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_502528.2 Gene:B0564.9 / 178266 WormBaseID:WBGene00007208 Length:423 Species:Caenorhabditis elegans


Alignment Length:434 Identity:78/434 - (17%)
Similarity:147/434 - (33%) Gaps:130/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFFWLDVLKQLDLKSRISFAASCDMFENIYVRS--SPLRLSRVVNLEEMIEFSLLETKLFVELS- 74
            |..||:::.:|.::..|....:....:|:..:|  |...|...::...:|..|:....:..:.| 
 Worm     2 DQAWLEIIDRLTIEDAIRLRRTSSKVDNLVSKSLKSMRHLDVQMHCPSVIRDSVAMASVIAQCSY 66

  Fly    75 -------------------GSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTK-------------- 106
                               .||::|.|    ..|.|..|:..:|..:.:.:              
 Worm    67 NLQTLDLKIRSDNAKYAGIPSDVKIRR----NVMTSINENATKLRKLHIDRCRISPGAIGSFGDL 127

  Fly   107 ---VNEIALEGFQLTQYKWFNAP--ETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYND 166
               :.||::....:...:|..|.  ..||..|    |::|:                  .|||.:
 Worm   128 PDSIEEISITNSMIECSEWDVATIIRKSFGTL----LKKCR------------------KLRYFE 170

  Fly   167 RLTGSCLMS------------LPTSLLSLYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHW 219
             ::|.|||:            :..::..|.|....:|..|.|.|| :..||:.|           
 Worm   171 -ISGQCLMNSHFHVDPKILQFISNTVEHLAIAVGHSLTINSLAFL-KDKRLKTL----------- 222

  Fly   220 HIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVP 284
            ::.|..:..|.|..:|.::....:.|..|               |.:.:.|:       .:.::.
 Worm   223 NLQRSFISPCDLEHIVAMADTITHLDLSR---------------SVNLLDCR-------QIAELV 265

  Fly   285 FLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPY-RPNDLLRLRNLTFLETLDLSNSPYI 348
            .||:|...:...|....:...||....:|..|.:....| ..|.|:.|.||..|:.|.|..    
 Worm   266 NLRHLSLKNNKEGVRDDSLQLIIKNCSKLEELSLDCCEYLTVNSLITLGNLNNLKQLSLPG---- 326

  Fly   349 TNEVVIELVIGIPNLSVLIVQGCPLLTNRVYLDAELASKKRSNG 392
                    ::.:.:...|.:..|..||   ||:.....:.:..|
 Worm   327 --------IVNVDDSVCLQISRCSKLT---YLNINFCRRVQKRG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 3/22 (14%)
leucine-rich repeat 157..179 CDD:275381 7/33 (21%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 4/25 (16%)
leucine-rich repeat 232..285 CDD:275381 5/52 (10%)
leucine-rich repeat 286..326 CDD:275381 9/40 (23%)
AMN1 306..>376 CDD:187754 16/70 (23%)
leucine-rich repeat 337..362 CDD:275381 3/24 (13%)
B0564.9NP_502528.2 leucine-rich repeat 106..130 CDD:275381 1/23 (4%)
leucine-rich repeat 131..159 CDD:275381 6/27 (22%)
leucine-rich repeat 166..193 CDD:275381 7/27 (26%)
leucine-rich repeat 195..214 CDD:275381 5/18 (28%)
leucine-rich repeat 219..243 CDD:275381 6/34 (18%)
leucine-rich repeat 244..266 CDD:275381 4/43 (9%)
leucine-rich repeat 267..293 CDD:275381 6/25 (24%)
leucine-rich repeat 294..318 CDD:275381 8/23 (35%)
leucine-rich repeat 319..343 CDD:275381 5/35 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.