DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL16

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_699181.2 Gene:FBXL16 / 146330 HGNCID:14150 Length:479 Species:Homo sapiens


Alignment Length:365 Identity:80/365 - (21%)
Similarity:146/365 - (40%) Gaps:112/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FDFFWLDVLKQLDLKSRISFAASCDMFENIY-----VRSSPLRLSRVVN--LEEMIEFSLLETKL 69
            |:.|.|..:..||:         |:..:|..     |::..|:.|.:.:  ||.|:|  .::..:
Human   168 FEGFCLVGVSDLDI---------CEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLE--QMQGVV 221

  Fly    70 FVELSGSDIEIIRGGPHTPMFSHF------------EDFIRLMSIRLTKVNEIALEGFQLTQ--Y 120
            .:||||.: :....|..:.:.:..            :|.|..:|..|..:.|::|:.:.:|.  .
Human   222 RLELSGCN-DFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTAL 285

  Fly   121 KWFNAPETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTG--SCLMSLPTSLLSL 183
            .:|.|.:...::.  :.|..|         ||...|             |  :.:.||| :|.:|
Human   286 AYFTARQGHSTHT--LRLLSC---------WEITNH-------------GVVNVVHSLP-NLTAL 325

  Fly   184 YITGCRNLCPN--QLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLL--VMVEISICSLNR 244
            .::||..:..:  :|:..|    ||:||:.||    .|         ||.:  :.:|...|.|:|
Human   326 SLSGCSKVTDDGVELVAEN----LRKLRSLDL----SW---------CPRITDMALEYVACDLHR 373

  Fly   245 DEYRLGELRYLQSLVIK--AHSTDT---------------IR--CKVSDWMLISLLDVPFLRNLM 290
                      |:.||:.  ...|||               :|  |:|.|:.|..||.:..||.|.
Human   374 ----------LEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLALGSLRLLS 428

  Fly   291 FSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLR 330
            .:..|  .::...||.:.:.::|..|::.|.|....:|.:
Human   429 LAGCP--LLTTTGLSGLVQLQELEELELTNCPGATPELFK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/22 (18%)
leucine-rich repeat 157..179 CDD:275381 4/23 (17%)
leucine-rich repeat 180..204 CDD:275381 6/25 (24%)
leucine-rich repeat 205..231 CDD:275381 8/25 (32%)
leucine-rich repeat 232..285 CDD:275381 17/73 (23%)
leucine-rich repeat 286..326 CDD:275381 10/39 (26%)
AMN1 306..>376 CDD:187754 5/25 (20%)
leucine-rich repeat 337..362 CDD:275381
FBXL16NP_699181.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
AMN1 201..413 CDD:332986 56/266 (21%)
leucine-rich repeat 220..243 CDD:275381 5/23 (22%)
leucine-rich repeat 244..269 CDD:275381 4/24 (17%)
LRR 1 244..266 3/21 (14%)
LRR 2 267..290 5/22 (23%)
leucine-rich repeat 270..295 CDD:275381 5/24 (21%)
leucine-rich repeat 296..321 CDD:275381 9/49 (18%)
LRR 3 319..343 7/24 (29%)
leucine-rich repeat 322..347 CDD:275381 7/28 (25%)
LRR 4 345..369 10/36 (28%)
leucine-rich repeat 348..373 CDD:275381 10/37 (27%)
LRR 5 371..395 8/33 (24%)
leucine-rich repeat 374..398 CDD:275381 6/23 (26%)
LRR 6 396..420 6/23 (26%)
LRR 7 446..470 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.