DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL14

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_689654.1 Gene:FBXL14 / 144699 HGNCID:28624 Length:418 Species:Homo sapiens


Alignment Length:402 Identity:85/402 - (21%)
Similarity:146/402 - (36%) Gaps:96/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHT 87
            ||::.:...|..|..:.:.....|..|     .:|..:........||..|....|.        
Human    20 LDVRDKGRAAQVCTAWRDAAYHKSVWR-----GVEAKLHLRRANPSLFPSLQARGIR-------- 71

  Fly    88 PMFSHFEDFIRLMSIR---------LTKVNEIALEG-FQLTQYKWFNAPETSFSNLTYVSLRRC- 141
                    .::::|:|         :..:..:.|.| :.||.....:|......:|..::|..| 
Human    72 --------RVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCK 128

  Fly   142 QLNDENLVG--WEFLTHLETLDLRYNDRLTGSCLMSLPTSLL----------SLYITGCRNLCPN 194
            |:.|.:| |  .::|..||.|:|       |.|.....|.||          ||.:..||:|...
Human   129 QITDSSL-GRIAQYLKGLEVLEL-------GGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDV 185

  Fly   195 QLIFLNRIPR--------LRELRASD---LMPGGHWHIYRDLVLACPLLVMVEISICSLNRDE-- 246
            .:..|..:.|        |.:|...|   |......||.|.|.    .|.::.:|.|....|.  
Human   186 GIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLT----GLRLLNLSFCGGISDAGL 246

  Fly   247 YRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISL---------LDVPFLRNLMFSDAPSGFVSAN 302
            ..|..:..|:||.::  |.|.|    ||..::.|         |||.|...          |...
Human   247 LHLSHMGSLRSLNLR--SCDNI----SDTGIMHLAMGSLRLSGLDVSFCDK----------VGDQ 295

  Fly   303 ALSIISR-FRQLRVLKMPNQPYRPNDLLRL-RNLTFLETLDLSNSPYITNEVVIELVIGIPNLSV 365
            :|:.|:: ...|:.|.:.:.....:.:.|: |.:..|.||::.....||::.:..:...:..|:.
Human   296 SLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTG 360

  Fly   366 LIVQGCPLLTNR 377
            :.:.||..:|.|
Human   361 IDLYGCTRITKR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/25 (32%)
leucine-rich repeat 157..179 CDD:275381 6/21 (29%)
leucine-rich repeat 180..204 CDD:275381 8/33 (24%)
leucine-rich repeat 205..231 CDD:275381 8/28 (29%)
leucine-rich repeat 232..285 CDD:275381 17/63 (27%)
leucine-rich repeat 286..326 CDD:275381 5/40 (13%)
AMN1 306..>376 CDD:187754 13/71 (18%)
leucine-rich repeat 337..362 CDD:275381 5/24 (21%)
FBXL14NP_689654.1 Required for down-regulation of SNAI1 2..48 6/32 (19%)
F-box-like 5..46 CDD:403981 5/25 (20%)
AMN1 90..296 CDD:187754 56/233 (24%)
leucine-rich repeat 92..118 CDD:275381 5/25 (20%)
leucine-rich repeat 119..142 CDD:275381 7/23 (30%)
LRR 1 144..163 8/25 (32%)
leucine-rich repeat 145..170 CDD:275381 9/31 (29%)
LRR 2 170..191 5/20 (25%)
leucine-rich repeat 171..203 CDD:275381 7/31 (23%)
LRR 3 203..225 6/21 (29%)
leucine-rich repeat 204..229 CDD:275381 8/28 (29%)
AMN1 228..401 CDD:187754 35/165 (21%)
LRR 4 229..250 4/20 (20%)
leucine-rich repeat 230..254 CDD:275381 5/23 (22%)
LRR 5 254..275 8/26 (31%)
leucine-rich repeat 255..280 CDD:275381 9/30 (30%)
leucine-rich repeat 281..306 CDD:275381 7/34 (21%)
leucine-rich repeat 307..331 CDD:275381 4/23 (17%)
leucine-rich repeat 332..357 CDD:275381 5/24 (21%)
leucine-rich repeat 358..382 CDD:275381 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.