DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and LOC110437745

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_021323868.1 Gene:LOC110437745 / 110437745 -ID:- Length:579 Species:Danio rerio


Alignment Length:39 Identity:11/39 - (28%)
Similarity:18/39 - (46%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 DEYRLGELRYLQSLVIKAHSTDTIRCKV---SDWMLISL 280
            ::.|.||::|..|:...|.|...:..:.   .||.|..|
Zfish   353 EDIRSGEVQYRHSVSTLAESESMMSVRSMRRKDWSLKDL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381
leucine-rich repeat 232..285 CDD:275381 11/39 (28%)
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
LOC110437745XP_021323868.1 RAD18 8..>99 CDD:333230
RING_Ubox 10..53 CDD:327409
zf-B_box 152..191 CDD:306989
SMC_N <213..>393 CDD:330553 11/39 (28%)
SPRY_PRY_C-I_1 407..575 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.