powered by:
Protein Alignment CG15056 and LOC110437745
DIOPT Version :9
Sequence 1: | NP_573291.1 |
Gene: | CG15056 / 32824 |
FlyBaseID: | FBgn0030918 |
Length: | 399 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021323868.1 |
Gene: | LOC110437745 / 110437745 |
-ID: | - |
Length: | 579 |
Species: | Danio rerio |
Alignment Length: | 39 |
Identity: | 11/39 - (28%) |
Similarity: | 18/39 - (46%) |
Gaps: | 3/39 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 245 DEYRLGELRYLQSLVIKAHSTDTIRCKV---SDWMLISL 280
::.|.||::|..|:...|.|...:..:. .||.|..|
Zfish 353 EDIRSGEVQYRHSVSTLAESESMMSVRSMRRKDWSLKDL 391
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170588051 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.