DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and fbxl13

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_002933148.2 Gene:fbxl13 / 100496930 XenbaseID:XB-GENE-6042355 Length:808 Species:Xenopus tropicalis


Alignment Length:481 Identity:99/481 - (20%)
Similarity:165/481 - (34%) Gaps:147/481 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFFWLDVLK------QLDLKSRISF----AASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLET 67
            |.|...:||      |...|.|..|    ....|.:.|.  .|||||... .|:.::...::|:.
 Frog   177 DAFMKKILKAWHAETQDSKKKREYFERLERGDMDDYGNF--NSSPLREGE-DNVSQLPPKAVLKI 238

  Fly    68 KLFVEL-----------------------SGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNE 109
            ..||:|                       |..|...:|        .:.:|...:.::|..::..
 Frog   239 FSFVDLIDLARSAQVCRSWKIISQNSSLWSSIDFSSVR--------QYVQDKFVVNTLRKCRLYV 295

  Fly   110 IALEGFQLTQYKW--FNAPETSFSNLTYVSLRRC-QLNDENL-VGWEFLTHLETLDLRYND---- 166
            |.|.....:...|  |.| .....||..::|..| .||||:: :..|....|..|::.:.|    
 Frog   296 IRLNFRSCSSLHWPTFKA-IGECKNLQDLNLSECIHLNDESIRIICEGCPALLYLNISHTDVTNA 359

  Fly   167 --RLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLAC 229
              |:...||::|  ..|||  ..||......|.:|.               .|.         .|
 Frog   360 TLRIVSRCLLNL--QFLSL--AYCRKFTDKGLQYLG---------------SGK---------GC 396

  Fly   230 PLLVMVEISIC---SLNRDEYRLGELRYLQSLVIKAHSTDTIRC------KVSDWMLISLLDVPF 285
            |.|:.:::|.|   |::...:.......||.|.|....|.|.:|      |..:.:.||||..|.
 Frog   397 PKLIYLDLSGCTQISVDGFTFLAAGCNSLQQLKINDMFTLTDKCITALLEKCQNILSISLLGSPH 461

  Fly   286 LRNLMFSDAPSG-----------------------------------------FVSANALSIISR 309
            |.::.|.....|                                         .||..|:|::..
 Frog   462 LSDVAFKVLAQGRKLAKIRIEGNNRITDSSIKAICKFCANLNHIYVADCQKITDVSLKAISVLKN 526

  Fly   310 FRQLRV---LKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGC 371
            ...|.|   :::.:...|  .:|...:.|.:..|:|:|...:::..::.:.....||:.|.::.|
 Frog   527 ITILNVADCIRISDPGVR--QVLEGPSGTKIRELNLTNCIRVSDLSLLRIAQKCHNLTYLSLRYC 589

  Fly   372 PLLTNRVYLDAELASKKRSNGNMVKV 397
            ..||:..:   ||.      |||..:
 Frog   590 ENLTDSGF---ELL------GNMASL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/24 (33%)
leucine-rich repeat 157..179 CDD:275381 7/27 (26%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 2/25 (8%)
leucine-rich repeat 232..285 CDD:275381 16/61 (26%)
leucine-rich repeat 286..326 CDD:275381 10/83 (12%)
AMN1 306..>376 CDD:187754 13/72 (18%)
leucine-rich repeat 337..362 CDD:275381 3/24 (13%)
fbxl13XP_002933148.2 Sfi1 <103..>206 CDD:369887 8/28 (29%)
F-box-like 227..271 CDD:372399 5/43 (12%)
leucine-rich repeat 242..266 CDD:275381 2/23 (9%)
leucine-rich repeat 267..287 CDD:275381 4/27 (15%)
leucine-rich repeat 295..308 CDD:275381 2/12 (17%)
AMN1 318..580 CDD:187754 58/291 (20%)
leucine-rich repeat 320..345 CDD:275381 8/24 (33%)
leucine-rich repeat 346..370 CDD:275381 6/23 (26%)
leucine-rich repeat 371..391 CDD:275381 7/23 (30%)
leucine-rich repeat 399..424 CDD:275381 4/24 (17%)
leucine-rich repeat 425..450 CDD:275381 8/24 (33%)
leucine-rich repeat 451..475 CDD:275381 8/23 (35%)
leucine-rich repeat 476..501 CDD:275381 0/24 (0%)
leucine-rich repeat 502..520 CDD:275381 2/17 (12%)
leucine-rich repeat 527..554 CDD:275381 4/28 (14%)
AMN1 538..697 CDD:187754 17/80 (21%)
leucine-rich repeat 555..580 CDD:275381 3/24 (13%)
leucine-rich repeat 581..605 CDD:275381 10/32 (31%)
leucine-rich repeat 606..626 CDD:275381 0/1 (0%)
leucine-rich repeat 630..655 CDD:275381
AMN1 656..>753 CDD:187754
leucine-rich repeat 656..681 CDD:275381
leucine-rich repeat 682..707 CDD:275381
leucine-rich repeat 708..733 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.