DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and si:ch73-236c18.7

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_021331546.1 Gene:si:ch73-236c18.7 / 100333378 ZFINID:ZDB-GENE-121214-3 Length:1015 Species:Danio rerio


Alignment Length:411 Identity:83/411 - (20%)
Similarity:123/411 - (29%) Gaps:176/411 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DVLKQLDL---------KSRI---------SFAASCDM-FENIYVRSSPLRLSRVVNLEEMIEFS 63
            :||.:|:|         :.|:         :..|.|:: .::..:.||.|:.|..| |.|:    
Zfish   677 EVLDELELQKYNTSDEGRRRLIPAVSNCTRALLAGCNLSAQDCEIVSSVLQSSNCV-LREL---- 736

  Fly    64 LLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPET 128
                    :||.:|::              :..::|:|..|...|                    
Zfish   737 --------DLSNNDLQ--------------DSGVKLLSDGLKSPN-------------------- 759

  Fly   129 SFSNLTYVSLRRCQLNDENLVGWEFL--------THLETLDLRYNDRLTG-SCLMSLPTSLLSLY 184
              ..|..:.|..|.:.:|   |..||        :||..|||.||.  .| |.:..|..:|...:
Zfish   760 --CQLEILRLSGCMVTEE---GCGFLSSALSSNPSHLRELDLSYNH--PGQSGVQLLQHTLEDPH 817

  Fly   185 ITGCRNLCPNQLIFLNR---IPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNR-- 244
            .|    |...:|.|..|   ||.||:...             ||.|. |.....::.:...||  
Zfish   818 YT----LQKLKLDFGGRSRIIPGLRKYAV-------------DLTLD-PNTANAQLQLSEGNRKA 864

  Fly   245 ------DEYRLGELRYLQSLVIKAHSTDTIRC-----------------------KVSD------ 274
                  .:|.....|:.....:....|.|.||                       .|||      
Zfish   865 THVKDPQQYPDHPERFDTYPQVLCKETLTGRCYWEAEWNGRVTGIAVASRGISRKGVSDCVFGWN 929

  Fly   275 ---WML-----------------ISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMP 319
               |.|                 |:....|..|..:|.|.||||||..::|.......|...   
Zfish   930 DKSWSLFCSDNSYVVCHNNDRTDITAPSPPSNRVGVFLDVPSGFVSFYSVSDTHTLTHLHTF--- 991

  Fly   320 NQPYRPNDLLRLRNLTFLETL 340
                         |.||.|.|
Zfish   992 -------------NTTFTEPL 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/30 (23%)
leucine-rich repeat 157..179 CDD:275381 9/22 (41%)
leucine-rich repeat 180..204 CDD:275381 7/26 (27%)
leucine-rich repeat 205..231 CDD:275381 5/25 (20%)
leucine-rich repeat 232..285 CDD:275381 14/109 (13%)
leucine-rich repeat 286..326 CDD:275381 11/39 (28%)
AMN1 306..>376 CDD:187754 6/35 (17%)
leucine-rich repeat 337..362 CDD:275381 2/4 (50%)
si:ch73-236c18.7XP_021331546.1 COG5635 102..>606 CDD:227922
FISNA 133..203 CDD:316956
NACHT 212..379 CDD:310381
LRR_RI <660..825 CDD:330982 41/205 (20%)
leucine-rich repeat 733..761 CDD:275378 9/75 (12%)
leucine-rich repeat 762..790 CDD:275378 7/30 (23%)
SPRY_PRY_SNTX 835..1012 CDD:294002 38/195 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.