DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and si:dkey-192l18.9

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_001344855.1 Gene:si:dkey-192l18.9 / 100005961 ZFINID:ZDB-GENE-120709-25 Length:476 Species:Danio rerio


Alignment Length:365 Identity:85/365 - (23%)
Similarity:129/365 - (35%) Gaps:101/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENL- 148
            |||.:.....|.:.|..:.......:.|  ......:|:|   .|:....:.::|   ||.|.| 
Zfish    94 PHTALIDILPDPVLLHILSYLSTPHLCL--CARVCRRWYN---LSWDPRLWSTIR---LNGELLN 150

  Fly   149 --VGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNR-IPRLRELRA 210
              ...:.|||....|       |.:..::|.|.:.|    |||.|....|..:.| .|.||.|..
Zfish   151 ADRALKVLTHRLCQD-------TPNVCLTLETVVAS----GCRRLSDRGLRVIARCCPELRCLEV 204

  Fly   211 SDLMPGGHWHIYR----DLVLACPLLVMVEISIC------SLNRD---------EYRLGELRYLQ 256
            :     |.:::..    |:|..||.|..:::|.|      ||..:         ..::| ||||.
Zfish   205 A-----GCYNVSNDAVFDVVSKCPNLEHLDVSGCPKVTCISLTEEGSVQHTPLHGQQIG-LRYLN 263

  Fly   257 -----SLVIKAHSTDTIRC------------KVSDWMLISL-LDVPFLRNLMFSDAPSGFVSANA 303
                 ||..|...|..|.|            :::|..|..| |....||.|..||.  ..|....
Zfish   264 MTDCVSLEDKGLKTIAIHCPRLTHLYLRRCIRITDESLRQLALHCTALRELSLSDC--HLVGDFG 326

  Fly   304 LSIISRFR-QLRVLKMPN------------QPYRPNDLLR------------------LRNLTFL 337
            |..::|.. :||.|.:.:            ..|.|.  ||                  .||...|
Zfish   327 LREVARLEGRLRYLSVAHCMRITDVGLRYVARYCPR--LRYLNARGCEGLTDQGLSYLARNCPRL 389

  Fly   338 ETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNR 377
            .::|:...|.:::..:..|......|..|.::||..||.|
Zfish   390 RSIDVGRCPLVSDAGLEVLAHCCKMLRRLSLRGCESLTGR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 6/25 (24%)
leucine-rich repeat 157..179 CDD:275381 3/21 (14%)
leucine-rich repeat 180..204 CDD:275381 7/24 (29%)
leucine-rich repeat 205..231 CDD:275381 7/29 (24%)
leucine-rich repeat 232..285 CDD:275381 20/85 (24%)
leucine-rich repeat 286..326 CDD:275381 12/52 (23%)
AMN1 306..>376 CDD:187754 19/100 (19%)
leucine-rich repeat 337..362 CDD:275381 4/24 (17%)
si:dkey-192l18.9XP_001344855.1 F-box-like 99..145 CDD:289689 7/53 (13%)
leucine-rich repeat 114..138 CDD:275381 4/28 (14%)
leucine-rich repeat 139..172 CDD:275381 10/42 (24%)
leucine-rich repeat 173..198 CDD:275381 9/28 (32%)
leucine-rich repeat 199..220 CDD:275381 5/25 (20%)
LRR_CC 222..246 CDD:197685 7/23 (30%)
leucine-rich repeat 225..258 CDD:275381 5/32 (16%)
leucine-rich repeat 259..284 CDD:275381 10/24 (42%)
AMN1 280..465 CDD:187754 34/154 (22%)
leucine-rich repeat 285..310 CDD:275381 4/24 (17%)
leucine-rich repeat 311..336 CDD:275381 8/26 (31%)
leucine-rich repeat 337..362 CDD:275381 4/24 (17%)
leucine-rich repeat 363..388 CDD:275381 4/24 (17%)
leucine-rich repeat 389..414 CDD:275381 4/24 (17%)
leucine-rich repeat 415..440 CDD:275381 7/15 (47%)
leucine-rich repeat 441..465 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.