DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32549 and Nt5dc2

DIOPT Version :9

Sequence 1:NP_728163.2 Gene:CG32549 / 32822 FlyBaseID:FBgn0052549 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_001361016.1 Gene:Nt5dc2 / 70021 MGIID:1917271 Length:553 Species:Mus musculus


Alignment Length:607 Identity:168/607 - (27%)
Similarity:273/607 - (44%) Gaps:113/607 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SRRLSLKSGEI-PKHGQGSQTAPSRIYPIHIGA--PNCQRSRRNKG---NRRLSCSYASLGRMQA 100
            :|||.|..|.. |:....|.:.|. ..|...||  |:..||....|   :..|...|..:.|:  
Mouse    10 ARRLLLCRGHSGPRAASSSPSCPG-CGPPGPGAHCPSTPRSAPADGADLSAHLWARYQDMRRL-- 71

  Fly   101 TPSEDAQPQDPLKSFERDFCDLPPYQCEMSDSAPNTPGPCSTSALPKKYYRYAAHRVFVNRSLHL 165
                           ..|.  |||..|.:.:.|                      .::.|..:.|
Mouse    72 ---------------VHDL--LPPEVCSLLNPA----------------------AIYANNEISL 97

  Fly   166 ENIKYYGFDMDYTLAEYKSPQYEQLGFNLVKERLV-FMGYPKEILQFEYDPTFPVRGLWFDTLYG 229
            .:::.||||.|||||:|....:.:: ||..::.|: ...||:.|.:::|||:|.:|||.:|....
Mouse    98 SDVEVYGFDYDYTLAQYADALHPEI-FNAARDILIEHYKYPEGIRKYDYDPSFAIRGLHYDIQKS 161

  Fly   230 NLLKVDA--YGNILVCVHGFEFIKHHQVYELYPNKFLKLDESRVYVLN-------------TLFN 279
            .|:|:||  |..:.....|.:.:...:|.:||..    .....:|.::             .:|:
Mouse   162 LLMKIDAFHYVQLGTAYRGLKPVPDDEVIDLYGG----TQHIPLYQMSGFYGKGPSIKQFMDIFS 222

  Fly   280 LPETYLLACLVD-FLTNSSDFVRVERGIKAGDLLFTYKSIFQDVRRAVDWVHSDGDLKRRTTQNM 343
            |||..||:|:|| ||.:..:|.:|.              :::||..|:..||..|.:.:...|:|
Mouse   223 LPEMALLSCVVDYFLGHGLEFDQVH--------------LYKDVTDAIRDVHVKGLMYQWIEQDM 273

  Fly   344 AHYVKKDERLPTVLSRIRESGAKLFMLTNSDYTYTNEIMTYLFDFPHGATPDEPHRDWKTYFDVI 408
            ..|:.:.:....||||:...|.:||::|||.:::.::.|.      |...|     ||:..|||:
Mouse   274 EKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMR------HMVGP-----DWRQLFDVV 327

  Fly   409 VVDARKPLFF-DEGTVLRQVDTKTGSLKIGTHVGPLQPGQVYSGGSCELFTKFINAKGKDVLYVG 472
            :|.|.||.|| |.....|::|.| |||. ...:..|:.|::|..|:...|.:....:|..|||.|
Mouse   328 IVQADKPNFFTDRRKPFRKLDEK-GSLH-WDRITRLEKGKIYRQGNLFDFLRLTEWRGPRVLYFG 390

  Fly   473 DHIFGDILKSKKIRGWRTFLIVPELVRELHVWTDECQLFA-----ELQNLDIKLGDLYRDLDSS- 531
            ||::.|:.......||||..|:|||.||:.:...|..:.:     .|..| ::....|:|.:|. 
Mouse   391 DHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGL-LERMQTYQDAESRQ 454

  Fly   532 --AKVKPDISQLRTCIRDVTHKMDMSYGMMGSLFRSGSRQTFFSSQVVRYADVYAATLLNLIYYP 594
              |....:..:|| ||...     :.....||:||:....|:||.::||::|:|.|:|..|:.|.
Mouse   455 VLATWMKERQELR-CITKA-----LFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYR 513

  Fly   595 FSYMFRAPAMLLPHESTVAHDQ 616
            ..:.|......|.||:.:..||
Mouse   514 VDFTFYPRRTPLQHEAPLWMDQ 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32549NP_728163.2 5_nucleotid 165..610 CDD:283430 140/470 (30%)
Nt5dc2NP_001361016.1 5_nucleotid 97..530 CDD:377556 141/471 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.