DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32549 and NT5DC2

DIOPT Version :9

Sequence 1:NP_728163.2 Gene:CG32549 / 32822 FlyBaseID:FBgn0052549 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_001127703.1 Gene:NT5DC2 / 64943 HGNCID:25717 Length:557 Species:Homo sapiens


Alignment Length:521 Identity:148/521 - (28%)
Similarity:248/521 - (47%) Gaps:87/521 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LPPYQCEMSDSAPNTPGPCSTSALPKKYYRYAAHRVFVNRSLHLENIKYYGFDMDYTLAEYKSPQ 186
            |||..|.:.:.|                      .::.|..:.|.:::.||||.|||||:|....
Human    80 LPPEVCSLLNPA----------------------AIYANNEISLRDVEVYGFDYDYTLAQYADAL 122

  Fly   187 YEQLGFNLVKERLV-FMGYPKEILQFEYDPTFPVRGLWFDTLYGNLLKVDA--YGNILVCVHGFE 248
            :.:: |:..::.|: ...||:.|.:::|:|:|.:|||.:|.....|:|:||  |..:.....|.:
Human   123 HPEI-FSTARDILIEHYKYPEGIRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQ 186

  Fly   249 FIKHHQVYELYPNKFLKLDESRVYVLN-------------TLFNLPETYLLACLVDFLTNSSDFV 300
            .:...:|.|||..    .....:|.::             .:|:|||..||:|:||:....|   
Human   187 PVPDEEVIELYGG----TQHIPLYQMSGFYGKGPSIKQFMDIFSLPEMALLSCVVDYFLGHS--- 244

  Fly   301 RVERGIKAGDLLFTYKSIFQDVRRAVDWVHSDGDLKRRTTQNMAHYVKKDERLPTVLSRIRESGA 365
                      |.|....:::||..|:..||..|.:.:...|:|..|:.:.:....||||:...|.
Human   245 ----------LEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGK 299

  Fly   366 KLFMLTNSDYTYTNEIMTYLFDFPHGATPDEPHRDWKTYFDVIVVDARKPLFF-DEGTVLRQVDT 429
            :||::|||.:::.::.|.      |...|     ||:..|||::|.|.||.|| |.....|::|.
Human   300 QLFLITNSPFSFVDKGMR------HMVGP-----DWRQLFDVVIVQADKPSFFTDRRKPFRKLDE 353

  Fly   430 KTGSLKIGTHVGPLQPGQVYSGGSCELFTKFINAKGKDVLYVGDHIFGDILKSKKIRGWRTFLIV 494
            | |||: ...:..|:.|::|..|:...|.:....:|..|||.|||::.|:.......||||..|:
Human   354 K-GSLQ-WDRITRLEKGKIYRQGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAII 416

  Fly   495 PELVRELHVWTDECQLFA-----ELQNLDIKLGDLYRDLDS----SAKVKPDISQLRTCIRDVTH 550
            |||.||:.:...|..:.:     .|..| ::....|:|.:|    :|.:| :..:|| ||...  
Human   417 PELEREIRIINTEQYMHSLTWQQALTGL-LERMQTYQDAESRQVLAAWMK-ERQELR-CITKA-- 476

  Fly   551 KMDMSYGMMGSLFRSGSRQTFFSSQVVRYADVYAATLLNLIYYPFSYMFRAPAMLLPHESTVAHD 615
               :.....||:||:....|:||.::||::|:|.|:|..|:.|...:.|......|.||:.:..|
Human   477 ---LFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYRVDFTFYPRRTPLQHEAPLWMD 538

  Fly   616 Q 616
            |
Human   539 Q 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32549NP_728163.2 5_nucleotid 165..610 CDD:283430 139/470 (30%)
NT5DC2NP_001127703.1 5_nucleotid 101..533 CDD:283430 139/470 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.