DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32549 and nt5dc1

DIOPT Version :9

Sequence 1:NP_728163.2 Gene:CG32549 / 32822 FlyBaseID:FBgn0052549 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_001098413.1 Gene:nt5dc1 / 568757 ZFINID:ZDB-GENE-030131-8274 Length:461 Species:Danio rerio


Alignment Length:376 Identity:93/376 - (24%)
Similarity:146/376 - (38%) Gaps:79/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GFDMDYTLAEYKSPQ-----YEQLGFNLVKERLVFMGYPKEILQF---EYDPTFPVRGLWFDTLY 228
            |||:|:||..|...:     ||.....||:.:    ||.|::|..   .:|  |..:||..|...
Zfish    14 GFDLDHTLCRYYLKETSRLIYESFARYLVEHK----GYDKDLLHLTPATWD--FCFKGLVVDLEE 72

  Fly   229 GNLLKVDAYGNILVCVHGFEFIKHHQVYELYPNK-----FLKLDES-----RVYVLNTLFNLPET 283
            |||:|:...|.:|...||.:.:....:.:.|..|     |..|:.|     :.|..:..|:||..
Zfish    73 GNLVKLAEDGTVLRATHGTKNLSTDDIVKHYGPKREWKHFNSLNTSYTRSAKYYFYDNYFDLPGA 137

  Fly   284 YLLACLVDFLTN-----SSDFVRVERGIKAGDLLFTYKSIFQDVRRAVDWVHSDGDLKRRTTQNM 343
            .|.|.:||.:..     :|||                   ::|:..|:|..::....:..|    
Zfish   138 LLCARVVDMMNKQGTEITSDF-------------------WKDIVAAIDHNYNTSAFREDT---- 179

  Fly   344 AHYVKKDERLP---------TV---LSRIRESGAKLFMLTNSDYTYTNEIMTYLFDFPHGATPDE 396
            ..|....:|.|         ||   |..|:.||..|.::|:|...|...:..::..         
Zfish   180 GTYFPSVKRCPGRYLQPCSDTVRRWLRSIKNSGKILLLITSSHSDYCRLVCEHILG--------- 235

  Fly   397 PHRDWKTYFDVIVVDARKPLFFDEGTVLRQVDTKTGSLKIGTHVGPLQPGQVYSGGSC----ELF 457
              .|::..||||:.:|.||.||......|...|....::....:..|:....||.|:.    ||.
Zfish   236 --SDFEELFDVIITNALKPGFFSLVPQQRPFRTLVDDVEDSEGLPSLEKPGWYSQGNWPHLHELL 298

  Fly   458 TKFINAKGKDVLYVGDHIFGDILKSKKIRGWRTFLIVPELVRELHVWTDEC 508
            ....|.....|:|.||.:..|:..:.....|.|.:||.|:..|.....|.|
Zfish   299 KTMTNKAEPKVVYFGDSMRSDMFPACSFAKWETVMIVEEMEGEGVPRADGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32549NP_728163.2 5_nucleotid 165..610 CDD:283430 93/376 (25%)
nt5dc1NP_001098413.1 5_nucleotid 6..341 CDD:302654 90/366 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.