DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32549 and CG1814

DIOPT Version :9

Sequence 1:NP_728163.2 Gene:CG32549 / 32822 FlyBaseID:FBgn0052549 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_610499.2 Gene:CG1814 / 35984 FlyBaseID:FBgn0033426 Length:548 Species:Drosophila melanogaster


Alignment Length:568 Identity:157/568 - (27%)
Similarity:259/568 - (45%) Gaps:122/568 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DPLKSFERDFCDLPPYQCE----------MSDSAPNTPGPCSTSALPK------KYYRYAAHR-- 156
            ||:.|      .|.|..|:          .||:..:.|...:..:.||      |.:.....:  
  Fly    29 DPISS------SLSPSPCKPNYSFEARAFASDAGASAPAATAQISHPKTVSDFQKLHEATKKKFQ 87

  Fly   157 ------------VFVNRSLHLENIKYYGFDMDYTLAEYKSPQYEQLGFNLVKERLV-FMGYPKEI 208
                        ||....|.|..::.||||.|||||.|| |..|.|.:||.:|.|| ...||::|
  Fly    88 SKKLPSDVHPDAVFACNELDLSEVQVYGFDYDYTLACYK-PILEDLLYNLAREMLVKRFRYPEDI 151

  Fly   209 LQFEYDPTFPVRGLWFDTLYGNLLKVDAY-----GNILVCVHGFEFIKHHQVYELYPNKFLKL-- 266
            ||.||:|.|.||||.:|...|.|:|:|::     |::   ..|...::..:|.:||.|:.|.:  
  Fly   152 LQLEYEPNFAVRGLHYDVEKGLLVKLDSFLQLQLGSV---YRGRTKVEADEVLKLYHNRLLPIAY 213

  Fly   267 -----------DESRVYVLNTLFNLPETYLLACLVDFLTNSSDFVRVERGIKAGDLLFTYKSIFQ 320
                       ..|::..|..||::||..||..::::...:    |::         :..:.:|.
  Fly   214 VEGPNNSYRHNTNSKMVQLADLFSVPEMCLLCNVIEYFERN----RID---------YNPEIVFH 265

  Fly   321 DVRRAVDWVH--SDGDLKRRTTQNMAHYVKKDERLPTVLSRIRESGAKLFMLTNSDYTYTNEIMT 383
            |.|.|:...|  ..|.:.|.|.:    |::::.:|.....:::::|..||::|||.|::.|..|:
  Fly   266 DTRTAMGSCHPIMHGKVMRNTEK----YIERNPKLVKFFEKLQQAGKNLFLVTNSPYSFVNCGMS 326

  Fly   384 YLFDFPHGATPDEPHRDWKTYFDVIVVDARKPLFF-DEGTVLRQVDTKTGSLKIGTHVGPLQPGQ 447
            :|.    ||       :|:.:|||::|.||||.|| ||...:|..|.:|.| .:...|..|:.|:
  Fly   327 FLV----GA-------NWRDFFDVVIVQARKPKFFTDESRPIRLFDERTQS-HLWDRVFKLEKGK 379

  Fly   448 VYSGGSCELFTKFINAKGKDVLYVGDHIFGDILKSKKIRGWRTFLIVPELVRELHV--------- 503
            :|..||.....:....:|..|||.|||.:.|:........|||..|:.||..|:..         
  Fly   380 IYYEGSVRQLQELKGWRGHSVLYFGDHPYSDLADVTLKHSWRTGAIISELAHEIKTLNRKDFKMS 444

  Fly   504 --WTDECQLFAELQNLDIKLGDLYRDLDSSAKV-----KPDISQLRTCIRDVTHKMDMSYGMMGS 561
              |         ||.|...:.|...|...:|::     ..:..|||...::|.::      ..||
  Fly   445 ANW---------LQMLTQLIEDTQDDDSEAAQICLKEWMEERDQLRNKTKNVFNE------QFGS 494

  Fly   562 LFRSGSRQTFFSSQVVRYADVYAATLLNLIYYPFSYMFRAPAMLLPHE 609
            :||:....|:||.::.|:||:|.:.:.||:.:..::.|.....::|||
  Fly   495 VFRTYHNPTYFSRRLFRFADIYTSDITNLLKFSTTHTFYPRRGVMPHE 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32549NP_728163.2 5_nucleotid 165..610 CDD:283430 142/483 (29%)
CG1814NP_610499.2 5_nucleotid 108..543 CDD:283430 142/483 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12103
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.