DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32549 and Nt5dc1

DIOPT Version :9

Sequence 1:NP_728163.2 Gene:CG32549 / 32822 FlyBaseID:FBgn0052549 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_001099863.2 Gene:Nt5dc1 / 294456 RGDID:1305214 Length:461 Species:Rattus norvegicus


Alignment Length:485 Identity:115/485 - (23%)
Similarity:190/485 - (39%) Gaps:127/485 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GFDMDYTLAEYKSPQYEQLGFN-----LVKERLVFMGYPKEILQFEY-DPTFPVRGLWFDTLYGN 230
            |||:|:||..|...:...|.:|     ||||:    ||.:|:|.... |..|..:||..|...|.
  Rat    14 GFDLDHTLCRYNLSESAALIYNSFAQFLVKEK----GYDEELLTLTLEDWDFCCKGLALDLEDGT 74

  Fly   231 LLKVDAYGNILVCVHGFEFIKHHQVYELYPNKFLK--LDESR-------------VYVLNTLFNL 280
            .:|:.|.|.:|...||.:.:....:.|.|..|..:  |.:.|             .|..:..|:|
  Rat    75 FIKLAADGTVLRASHGTKMMTPEALTEAYGKKEWRHCLSDKRSVSGSDIPCCSGKCYFYDNYFDL 139

  Fly   281 PETYLLACLVDFLTNSS------DFVR-VERGIKAGDLLFTYKS----IFQDVRRAVDWVHSDGD 334
            |...|.|.:||.||..:      ||.: |..||:....:..:|.    .|.:::|          
  Rat   140 PGALLCAKVVDSLTKQNRGQKTFDFWKDVVAGIQHNFKMSAFKENCGFFFPEIKR---------- 194

  Fly   335 LKRRTTQNMAHYVKK-DERLPTVLSRIRESGAKLFMLTNSDYTYTNEIMTYLFDFPHGATPDEPH 398
                   |:..||.: .|.:...|.:|:::|....::|:|...|...:.:|:..           
  Rat   195 -------NLGKYVYRCPESVKKWLQQIKDAGKITMLITSSHSDYCKLLGSYILG----------- 241

  Fly   399 RDWKTYFDVIVVDARKPLFF---------------DEGTVLRQVDTKTGSLKIGTHVGPLQPGQV 448
            :|:...||:::.:|.||.||               :|...|..:|               :||. 
  Rat   242 KDFADLFDIVITNALKPGFFSHFPSQRSFYTLENDEEKDELPSLD---------------KPGW- 290

  Fly   449 YSGGSC----ELFTKFINAKGKDVLYVGDHIFGDILKSKKIRGWRTFLIVPELVRELHVWTDECQ 509
            ||.|:.    ||..|..:.....|:|.||.:..||..:.....|.|.||:.||..:      |.:
  Rat   291 YSQGNAVHLYELLKKMTSKLEPKVVYFGDSMHSDIFPAHHYTNWETVLILEELQGQ------EME 349

  Fly   510 LFAELQNLDIKLGDLYRDLDSSAKVKPDISQLRTCIRDVTHKMDMSYGMMGSLFRSGSRQ----- 569
            ...|.:.|: |.|..     ...||||        :..:::|.. || .:.|:.|.|:.:     
  Rat   350 KPEEAEPLE-KRGKY-----EGPKVKP--------LNCLSNKWG-SY-FIDSVSRRGNAEDSLVY 398

  Fly   570 TFFSSQVVRYADVYAATLLNLIYYPFSYMF 599
            |:.|.::..|:.:....:.::...|..|.|
  Rat   399 TWSSKRISTYSTIAIPNIESIAELPLDYKF 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32549NP_728163.2 5_nucleotid 165..610 CDD:283430 115/485 (24%)
Nt5dc1NP_001099863.2 HAD_like 3..343 CDD:419670 92/376 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.