DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaCOP and Ap4b1

DIOPT Version :9

Sequence 1:NP_523400.1 Gene:betaCOP / 32820 FlyBaseID:FBgn0008635 Length:964 Species:Drosophila melanogaster
Sequence 2:NP_001157024.1 Gene:Ap4b1 / 67489 MGIID:1337130 Length:738 Species:Mus musculus


Alignment Length:517 Identity:105/517 - (20%)
Similarity:193/517 - (37%) Gaps:115/517 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ETLKRVIKLLLNGE------RYPGLIMTIIRFVLPVQNHTIKKLLL--IFWEIVPKTSADGKLLQ 94
            :.:|.:.|.|.|..      ||..:|..:||       |..:.|.:  :|.|:| |.||...::|
Mouse     8 DVVKELKKALCNPHIQADRLRYRNVIQRVIR-------HMTQGLDMSDVFMEMV-KASATVDIVQ 64

  Fly    95 E-----------------MILVCDAYRKDLQHPNEFLRGSTLRFLCKLKEPELLEPLMPAIRACL 142
            :                 .:|..:...||...||..:||..||.:|.|:.|.:.|.:...:...|
Mouse    65 KKLVYLYMGTYAPLKPDLALLAINTLCKDCSDPNPMVRGLALRSMCSLRMPGVQEYIQQPVVNGL 129

  Fly   143 DHRHSYVRRNAVLAIFTIYKNFDWLVPDGP---ELIASFLDTQQD----MSCKRNAFLMLLHADQ 200
            ..:.|||||.|||....::........||.   ||.:...|  ||    ::|.|:...:|   .|
Mouse   130 RDKASYVRRVAVLGCAKMHNLHGDSEVDGALVNELYSLLRD--QDPIVVVNCLRSLEEIL---KQ 189

  Fly   201 ERAL-------NYLASCIDQVHTFGDILQLVIVELIYKVCHANPAERSRFIRCIYNLLNSSSNAV 258
            |..:       ::|.:.:.::..:|.      .|::..:....|.....    ::::||...:.:
Mouse   190 EGGVVINKPIAHHLLNRMSKLDQWGQ------AEVLNFLLRYQPRSEEE----LFDILNLLDSYL 244

  Fly   259 RYESAGTLITLSLAPTAIKAAASCYIELVVK--ESDNNVKLIVLDRLVAMKEHEGMEKVMQDL-- 319
            :..|.|          .:..|...::.|..|  ....:|.:.|...|:|....|..|.....|  
Mouse   245 KSSSTG----------VVMGATKLFLILAKKFPHVQTDVLVRVKGPLLAACSSESRELCFAALCH 299

  Fly   320 VMDVLRVL---------------AAPDIEVRRKTLALALDLVYSRNIGEMVLVLK---KEVAKTH 366
            |..||..|               :.|.. ::.:.:.:..:||...|:.:::..|:   .:||   
Mouse   300 VRQVLHSLPGHFSSHYKKFFCSYSEPHY-IKLQKVEVLCELVNDENVQQVLEELRGYCTDVA--- 360

  Fly   367 NVEHEDTGKYRQLLVRTLHTCSIKFPDVAANVIPVLVEFLSDTNELAAADVLIFIREAIQKFPAL 431
                   ..:.|..:..:.:.:..:.|   ..:.:|.|.|....|.....|:...|:.:...|..
Mouse   361 -------ADFAQAAIFAIGSIAKTYTD---QCVQILTELLGLRQEHITTVVVQTFRDLVWLCPQC 415

  Fly   432 RALIIEHLIEAFPQIKSSKIHRAAVWILGEYVEGSQILEVIAVIQQTLGEV-----PMVEAE 488
            ...:.:.|......|:.|:..:|.:|:||  |.|.:|.....|::..:..|     |.|:.|
Mouse   416 TEAVCQALPGCEENIQDSEGKQALIWLLG--VHGEKIPNAPYVLEDFVDNVKSETFPAVKME 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaCOPNP_523400.1 Adaptin_N 17..562 CDD:279882 105/517 (20%)
Coatamer_beta_C 678..820 CDD:285019
Coatomer_b_Cpla 826..953 CDD:291472
Ap4b1NP_001157024.1 Adaptin_N 9..525 CDD:396262 105/516 (20%)
HEAT repeat 86..113 CDD:293787 9/26 (35%)
HEAT repeat 120..150 CDD:293787 9/29 (31%)
HEAT repeat 159..185 CDD:293787 7/27 (26%)
HEAT repeat 198..222 CDD:293787 3/29 (10%)
Hinge. /evidence=ECO:0000250|UniProtKB:Q9Y6B7 534..600
Ear, mediates interaction with TEPSIN. /evidence=ECO:0000250|UniProtKB:Q9Y6B7 601..738
B2-adapt-app_C 620..729 CDD:401126
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.