DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaCOP and AP4B1

DIOPT Version :9

Sequence 1:NP_523400.1 Gene:betaCOP / 32820 FlyBaseID:FBgn0008635 Length:964 Species:Drosophila melanogaster
Sequence 2:NP_001240781.1 Gene:AP4B1 / 10717 HGNCID:572 Length:739 Species:Homo sapiens


Alignment Length:541 Identity:108/541 - (19%)
Similarity:196/541 - (36%) Gaps:154/541 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RDLEKGDTNVKIE--------TLKRVIKLLLNGERYPGLIMTIIRFVLPVQNHTIKKLLLIFWEI 82
            ::|:|...|..|:        .::|||:.:..|....|:.|.:::....| :...|||:.::...
Human    11 KELKKALCNPHIQADRLRYRNVIQRVIRYMTQGLDMSGVFMEMVKASATV-DIVQKKLVYLYMCT 74

  Fly    83 VPKTSADGKLLQEMILVCDAYRKDLQHPNEFLRGSTLRFLCKLKEPELLEPLMPAIRACLDHRHS 147
            ......|..|| .:..:|    ||...||..:||..||.:|.|:.|.:.|.:...|...|..:.|
Human    75 YAPLKPDLALL-AINTLC----KDCSDPNPMVRGLALRSMCSLRMPGVQEYIQQPILNGLRDKAS 134

  Fly   148 YVRRNAVLAIFTIYKNFDWLVPDGP---ELIASFLDTQQD----MSCKRNAFLMLLHADQERAL- 204
            ||||.|||....::........||.   ||.:...|  ||    ::|.|:...:|   .||..: 
Human   135 YVRRVAVLGCAKMHNLHGDSEVDGALVNELYSLLRD--QDPIVVVNCLRSLEEIL---KQEGGVV 194

  Fly   205 ------NYLASCIDQVHTFGDILQLVIVELIYKVCHANPAERSRFIRCIYNLLNSSSNAVRYESA 263
                  ::|.:.:.::..:|.      .|::..:....|.....    ::::||...:.::..|.
Human   195 INKPIAHHLLNRMSKLDQWGQ------AEVLNFLLRYQPRSEEE----LFDILNLLDSFLKSSSP 249

  Fly   264 GTLITLSLAPTAIKAAASCYIELVVKESDNNVKLIVLDRLVAMKEHEGMEKVMQDLVMDVLRVLA 328
            |.::                         ...||.::           :.|:...:..|||    
Human   250 GVVM-------------------------GATKLFLI-----------LAKMFPHVQTDVL---- 274

  Fly   329 APDIEVRRKTLALALDLVYSRNIGEMVLVLKKEVAKTHNVEHEDTGKYRQLLVRTLHTCSIKFPD 393
                 ||.|...||.....||.:..:.|...:::  .|::....:..|::..      ||...|.
Human   275 -----VRVKGPLLAACSSESRELCFVALCHVRQI--LHSLPGHFSSHYKKFF------CSYSEPH 326

  Fly   394 -VAANVIPVLVEFLSDTN-----------------ELAAADVL-------IFIREAIQKFPALRA 433
             :....:.||.|.::|.|                 :.|.|.:.       .:..:.:|....|..
Human   327 YIKLQKVEVLCELVNDENVQQVLEELRGYCTDVSADFAQAAIFAIGGIARTYTDQCVQILTELLG 391

  Fly   434 LIIEHL----IEAF-------PQ---------------IKSSKIHRAAVWILGEYVEGSQILEVI 472
            |..||:    ::.|       ||               |:.|:..:|.:|:||  |.|.:|....
Human   392 LRQEHITTVVVQTFRDLVWLCPQCTEAVCQALPGCEENIQDSEGKQALIWLLG--VHGERIPNAP 454

  Fly   473 AVIQQTLGEV-----PMVEAE 488
            .|::..:..|     |.|:.|
Human   455 YVLEDFVENVKSETFPAVKME 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaCOPNP_523400.1 Adaptin_N 17..562 CDD:279882 108/541 (20%)
Coatamer_beta_C 678..820 CDD:285019
Coatomer_b_Cpla 826..953 CDD:291472
AP4B1NP_001240781.1 Adaptin_N 9..525 CDD:331138 108/541 (20%)
HEAT repeat 86..113 CDD:293787 10/30 (33%)
HEAT repeat 120..150 CDD:293787 10/29 (34%)
HEAT repeat 159..185 CDD:293787 7/27 (26%)
HEAT repeat 198..222 CDD:293787 3/29 (10%)
Hinge. /evidence=ECO:0000305|PubMed:26542808 534..600
Ear, mediates interaction with TEPSIN. /evidence=ECO:0000269|PubMed:26542808 601..739
B2-adapt-app_C 621..730 CDD:312560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.