DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and CREB5

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_016868296.1 Gene:CREB5 / 9586 HGNCID:16844 Length:537 Species:Homo sapiens


Alignment Length:355 Identity:71/355 - (20%)
Similarity:113/355 - (31%) Gaps:83/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AVGGGGGGGGG---GGGGNP--------QQQQQNPQSTTAGGPTGATNNAQG---GGVSSVL--- 79
            ||||...|.|.   .....|        ||...:|||::......:||...|   |.:||:|   
Human   133 AVGGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLH 197

  Fly    80 ------------------TTTANCNIQYPIQTLAQHGLQVQSVIQANPSGVIQTAAGTQQQQQAL 126
                              |...:..:..|:    :..:.|.|.|.......:.....:.|.|...
Human   198 NRQRQPMPASMPGTLPNPTMPGSSAVLMPM----ERQMSVNSSIMGMQGPNLSNPCASPQVQPMH 258

  Fly   127 AAATAMQKVVYVAKP---PNSTVIHTTPGNAVQV-------------------RNKIPPTFPCKI 169
            :.|....|......|   .|..:  .|.|:.:::                   ...:||..|...
Human   259 SEAKMRLKAALTHHPAAMSNGNM--NTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPH 321

  Fly   170 KPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGT 234
            :.:....||........:....|..|.|...|::::  |....|..:|....:|......|    
Human   322 QHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQ--TSPHPPLHTGNQAQVSPATQQMQ---- 380

  Fly   235 GAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKC 299
                  ...::....||.....|:        :.||...:|...|::||.||..||:|:|.::..
Human   381 ------PTQTIQPPQPTGGRRRRV--------VDEDPDERRRKFLERNRAAATRCRQKRKVWVMS 431

  Fly   300 LENRVAVLENQNKALIEELKSLKELYCQTK 329
            ||.:...|...|..|..|:..||....|.|
Human   432 LEKKAEELTQTNMQLQNEVSMLKNEVAQLK 461



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.