DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and SKO1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_014232.1 Gene:SKO1 / 855554 SGDID:S000005111 Length:647 Species:Saccharomyces cerevisiae


Alignment Length:440 Identity:83/440 - (18%)
Similarity:148/440 - (33%) Gaps:152/440 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSIVEENGNSSAASGSNDVVDVVAQQAAAAVGGGGGGGGGGGGGNPQQQQQ---NPQSTTAGGPT 64
            |||.||||||:....||.  :.|.:.:.:.:              |.||:.   :|...|.||..
Yeast    70 NSIPEENGNSTVTDNSNH--NDVKKDSPSFL--------------PGQQRPTIISPPILTPGGSK 118

  Fly    65 GATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQANPSGV-IQTAAGTQQQQQALAA 128
            ..........:.....:|.|     |.|.  .|.:   ||..:|||.: :.:.:|:.....:..:
Yeast   119 RLPPLLLSPSILYQANSTTN-----PSQN--SHSV---SVSNSNPSAIGVSSTSGSLYPNSSSPS 173

  Fly   129 ATAMQKVVYVAKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSD---DDS 190
            .|::     :.:|.||.|..:..||.....:...|.|...:.....|.:..:....|:.   ..|
Yeast   174 GTSL-----IRQPRNSNVTTSNSGNGFPTNDSQMPGFLLNLSKSGLTPNESNIRTGLTPGILTQS 233

  Fly   191 QHH-------RSELTRRPSYNKIFT-----------EISGPDMSGA----------SLP------ 221
            .::       ::.:|...:.||..|           .|..|.::|.          :||      
Yeast   234 YNYPVLPSINKNTITGSKNVNKSVTVNGSIENHPHVNIMHPTVNGTPLTPGLSSLLNLPSTGVLA 298

  Fly   222 -----------MSDGVLNSQLAGTGAGGNAANSSLMQLD-------------------------- 249
                       .:||.:|:.::.:....|.:..:.:::|                          
Yeast   299 NPVFKSTPTTNTTDGTVNNSISNSNFSPNTSTKAAVKMDNPAEFNAIEHSAHNHKENENLTTQIE 363

  Fly   250 --------------------PTYYLSNRMSYNTNNSGIA-----------------------EDQ 271
                                .|...|.:.|.:..||.:.                       |:|
Yeast   364 NNDQFNNKTRKRKRRMSSTSSTSKASRKNSISRKNSAVTTAPAQKDDVENNKISNNVTLDENEEQ 428

  Fly   272 TRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKSL 321
            .|||:..|::||.||.:.|::||||||.:||.:...|::...|.:.:..|
Yeast   429 ERKRKEFLERNRVAASKFRKRKKEYIKKIENDLQFYESEYDDLTQVIGKL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
SKO1NP_014232.1 Aft1_HRA <196..>228 CDD:371723 4/31 (13%)
bZIP_ATF2 431..482 CDD:269835 19/48 (40%)
coiled coil 432..482 CDD:269835 18/47 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.