DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and CREB3L3

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_115996.1 Gene:CREB3L3 / 84699 HGNCID:18855 Length:461 Species:Homo sapiens


Alignment Length:346 Identity:74/346 - (21%)
Similarity:108/346 - (31%) Gaps:132/346 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GGGGGGGNPQQQQQNPQ-----STTAGG----PTGATNNAQG--GGVSSVLTTTANCNIQYPIQT 93
            |.|.|....||...||.     |:..|.    |:....:.:|  .|:|..|.:..          
Human    43 GEGWGHVKDQQVLPNPDSDDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDP---------- 97

  Fly    94 LAQHGLQVQSVIQANP--SGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQ 156
                        |..|  ||...:.||....|..        |...::..|.::...||||..:|
Human    98 ------------QDTPPRSGPATSPAGCHPAQPG--------KGPCLSYHPGNSCSTTTPGPVIQ 142

  Fly   157 VRNKI-----------------PPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHR---------- 194
            |....                 .|..|..:.|..|....:......|.|..|||.          
Human   143 VPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGA 207

  Fly   195 ---SELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSN 256
               .||.......|:..:      .|.:||                        .||..|.|   
Human   208 GHCQELVLTEDEKKLLAK------EGITLP------------------------TQLPLTKY--- 239

  Fly   257 RMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAV--------------L 307
                        |::..|:..|..:|:::|:|.|:||||||..||.|::.              |
Human   240 ------------EERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHL 292

  Fly   308 ENQNKALIEELKSLKELYCQT 328
            |.||.:|:|:||.|:.:..|:
Human   293 EKQNLSLLEQLKKLQAIVVQS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
CREB3L3NP_115996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..120 18/98 (18%)
DUF2207 <169..>266 CDD:303056 27/141 (19%)
bZIP_CREB3 244..304 CDD:269837 21/59 (36%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 245..274 14/28 (50%)
coiled coil 246..297 CDD:269837 17/50 (34%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 285..306 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..408
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.