powered by:
Protein Alignment CrebB and bZIP
DIOPT Version :9
Sequence 1: | NP_001334685.1 |
Gene: | CrebB / 32817 |
FlyBaseID: | FBgn0265784 |
Length: | 331 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_177054.1 |
Gene: | bZIP / 843221 |
AraportID: | AT1G68880 |
Length: | 138 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 28/72 - (38%) |
Similarity: | 45/72 - (62%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 254 LSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEEL 318
|||..:.:.::|..|||..|||. |...|||:||..|.:|:.:::.|.:.:..|.|:||:|::||
plant 28 LSNLPATSDDSSRTAEDNERKRR-RKVSNRESARRSRMRKQRHMEELWSMLVQLINKNKSLVDEL 91
Fly 319 KSLKELY 325
...:|.|
plant 92 SQARECY 98
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.