DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and bZIP

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_177054.1 Gene:bZIP / 843221 AraportID:AT1G68880 Length:138 Species:Arabidopsis thaliana


Alignment Length:72 Identity:28/72 - (38%)
Similarity:45/72 - (62%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 LSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEEL 318
            |||..:.:.::|..|||..|||. |...|||:||..|.:|:.:::.|.:.:..|.|:||:|::||
plant    28 LSNLPATSDDSSRTAEDNERKRR-RKVSNRESARRSRMRKQRHMEELWSMLVQLINKNKSLVDEL 91

  Fly   319 KSLKELY 325
            ...:|.|
plant    92 SQARECY 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
bZIPNP_177054.1 bZIP_plant_GBF1 48..98 CDD:269850 19/50 (38%)
coiled coil 48..98 CDD:269850 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.