DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and bZIP58

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_172817.2 Gene:bZIP58 / 837921 AraportID:AT1G13600 Length:196 Species:Arabidopsis thaliana


Alignment Length:145 Identity:32/145 - (22%)
Similarity:61/145 - (42%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 NKIFTEISG------PDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYN- 261
            |.|..|::|      ||......|    ::.|:.....:...:.:|       .|:|:..::.| 
plant     2 NTIPAELTGYFHYLPPDKYNNQTP----IMESEYFNMPSSPTSCSS-------FYHLNGLINNNN 55

  Fly   262 ------------TNNSGIAEDQTR------KREIRLQKNREAARECRRKKKEYIKCLENRVAVLE 308
                        :|||...||..:      :::.|:..|||:||..|.:|:.::..|.::|..|.
plant    56 YSSSSNGQDLMTSNNSTSDEDHQQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLR 120

  Fly   309 NQNKALIEELKSLKE 323
            ..|..|:::|..:.|
plant   121 TDNHCLMDKLNRVSE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
bZIP58NP_172817.2 Smc <75..>179 CDD:224117 17/61 (28%)
bZIP_plant_GBF1 87..137 CDD:269850 15/49 (31%)
coiled coil 87..137 CDD:269850 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.