DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and BZIP9

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_568457.1 Gene:BZIP9 / 832549 AraportID:AT5G24800 Length:277 Species:Arabidopsis thaliana


Alignment Length:119 Identity:33/119 - (27%)
Similarity:51/119 - (42%) Gaps:13/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 RPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNN 264
            |.:.:.|...:|......|:.|...|.:..    |.:|.:..||.    |.........|..|| 
plant    61 RDAQSSICENLSADSPVSANKPEVRGGVRR----TTSGSSHVNSD----DEDAETEAGQSEMTN- 116

  Fly   265 SGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEEL 318
                :....||..|:..|||:|:..||:|:||:..||.:|..|:..|..|.::|
plant   117 ----DPNDLKRIRRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
BZIP9NP_568457.1 bZIP_plant_GBF1 123..174 CDD:269850 18/44 (41%)
coiled coil 123..174 CDD:269850 18/44 (41%)
bZIP_C 189..>266 CDD:403631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.