DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and bZIP6

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001189580.1 Gene:bZIP6 / 816816 AraportID:AT2G22850 Length:227 Species:Arabidopsis thaliana


Alignment Length:147 Identity:38/147 - (25%)
Similarity:59/147 - (40%) Gaps:39/147 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 KIFTEISGPDMS------------------GASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPT 251
            ||.|:.:|.|.|                  |...|.|| .|:|:  .|....||.|         
plant    60 KINTDFNGFDESCIGSIKTNSGSDDSNLFHGVPSPQSD-ELDSK--NTKIRSNATN--------- 112

  Fly   252 YYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIE 316
               .||...|.:...:.:|:.||   |::.|||:|:..|.:|:.:|..|::....|..:|:.|..
plant   113 ---HNRNKLNRSVLQVTDDRKRK---RMESNRESAKRSRMRKQRHIDNLKDEANRLGLENRELAN 171

  Fly   317 ELKSLK---ELYCQTKN 330
            .|:.:.   .|.|...|
plant   172 RLRIVLYNIALMCTDNN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
bZIP6NP_001189580.1 bZIP_plant_GBF1 130..177 CDD:269850 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.