DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and atf6b

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001071188.1 Gene:atf6b / 777612 ZFINID:ZDB-GENE-061103-166 Length:673 Species:Danio rerio


Alignment Length:269 Identity:61/269 - (22%)
Similarity:91/269 - (33%) Gaps:83/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQANPSGVIQTAAGTQQQ 122
            |.|..|..|.          .|:...:..:..|..||....: |.|.....|..|..||......
Zfish   151 TVASAPQPAV----------PLSAHTHTTVLSPAATLKASSI-VSSKPLLQPKPVCVTALPVAPS 204

  Fly   123 QQALAAATAMQKVVYVAKPP----NSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDE 183
            ..| |.|..:|.|......|    :||.:..:|...      :.|. |..:|.||          
Zfish   205 ATA-AKALILQSVPVPVPVPTLEQSSTPVVLSPSVC------LAPA-PAIVKMEP---------- 251

  Fly   184 SLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQL 248
             ||              ||.         |..|..|.|.|..::.:..|  ...||..:...|::
Zfish   252 -LS--------------PSM---------PHCSSPSAPQSKPIVPATAA--ALPGNIGSDIDMKV 290

  Fly   249 DPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKA 313
                                    .||:.|:.||||:|.:.|:|||||::.||.::...:.:|:.
Zfish   291 ------------------------LKRQQRMIKNRESACQSRKKKKEYLQNLETQLRDAQQENER 331

  Fly   314 LIEELKSLK 322
            |..|..:|:
Zfish   332 LRRENHTLR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
atf6bNP_001071188.1 bZIP_ATF6 293..343 CDD:269848 19/48 (40%)
coiled coil 293..343 CDD:269848 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.