DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and CREB3L2

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_919047.2 Gene:CREB3L2 / 64764 HGNCID:23720 Length:520 Species:Homo sapiens


Alignment Length:265 Identity:63/265 - (23%)
Similarity:103/265 - (38%) Gaps:68/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPP---NSTV----------IHTT 150
            ::.:.|....|.|::.:...|     ..|.:|.::|    .:||   |:.|          |...
Human   125 IKTEPVTDEPPPGLVPSVTLT-----ITAISTPLEK----EEPPLEMNTGVDSSCQTIIPKIKLE 180

  Fly   151 PGNAVQVRNKIPPTFP---CKIKPEPNTQHPEDSDESLSDDDSQHHRS-ELTRRPSYNKIFTEIS 211
            |....|..|..|...|   ..:.|.|.:.|..||:.|||.:...|..| ..|..||         
Human   181 PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPS--------- 236

  Fly   212 GPDMSGASLPMSDGVLNS--------QLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIA 268
                  .:.|.:...|:|        :|.|:|............:...|.:..::..:.     :
Human   237 ------RAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSK-----S 290

  Fly   269 EDQTRKREIRLQKNREAARECRRKKKEYIKCLE--------------NRVAVLENQNKALIEELK 319
            |::..|:..|..||:.:|:|.|||||||:..||              .:|.||||.|:.|:::|:
Human   291 EEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQ 355

  Fly   320 SLKEL 324
            .|:.|
Human   356 KLQTL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
CREB3L2NP_919047.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..264 20/83 (24%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 296..325 15/28 (54%)
bZIP_CREB3 305..348 CDD:269837 16/42 (38%)
coiled coil 305..348 CDD:269837 16/42 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 336..357 8/20 (40%)
S1P recognition. /evidence=ECO:0000303|PubMed:17178827 427..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.