DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and fosl1a

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_009289400.1 Gene:fosl1a / 564241 ZFINID:ZDB-GENE-061207-7 Length:347 Species:Danio rerio


Alignment Length:280 Identity:58/280 - (20%)
Similarity:104/280 - (37%) Gaps:101/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GNPQQ--QQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQAN 108
            |||.:  .:..|:|::  |.:|:::       :||.|||..          .|...|..||    
Zfish     5 GNPGRGIDRSFPESSS--GSSGSSS-------ASVATTTGT----------TQQQQQKYSV---- 46

  Fly   109 PSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEP 173
                    ||:.|...:|.|.|:.|.:.::.:|...|   ..|..|::....:||..|..:.|  
Zfish    47 --------AGSGQFVPSLNAITSNQSLQWMLQPSIGT---PGPSRALRSSYPLPPGIPATMNP-- 98

  Fly   174 NTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGG 238
                |:.|...||             ||                       ||:.: .|..|:  
Zfish    99 ----PQPSQSHLS-------------RP-----------------------GVIRA-AAAIGS-- 120

  Fly   239 NAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENR 303
                                :...|:..::.::..:|.||.::|:.||.:||.:::|....|:|.
Zfish   121 --------------------TTRRNDEYLSPEELERRRIRRERNKMAAAKCRNRRRELTDTLQNE 165

  Fly   304 VAVLENQNKALIEELKSLKE 323
            ...||::...|.:|:..|::
Zfish   166 TDQLEDEKSRLQKEIADLQK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
fosl1aXP_009289400.1 bZIP_Fos 144..197 CDD:269869 13/42 (31%)
coiled coil 144..196 CDD:269869 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.