DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and cremb

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_021325839.1 Gene:cremb / 550357 ZFINID:ZDB-GENE-050417-150 Length:404 Species:Danio rerio


Alignment Length:175 Identity:52/175 - (29%)
Similarity:86/175 - (49%) Gaps:38/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 FPCKIK-PEPNTQHPEDSDESLSDDDSQHH--------------RSELTRRPSYNKIFTEISGPD 214
            ||.|:: ..||.        |:|.:.|.|.              ||.:|:...:::..|.|...:
Zfish   237 FPAKLRITLPNV--------SMSPNGSVHFIPCQQRYENFSSWPRSPVTQFAVHSRNGTYIVSNN 293

  Fly   215 MSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRL 279
            ...|:   :.|:...|::...:|    .|.:|...|....|.::        :||:.:||||:||
Zfish   294 QGQAT---TGGMSGYQMSSPASG----LSQVMDSSPDSLPSPQL--------LAEEASRKRELRL 343

  Fly   280 QKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKSLKEL 324
            .|||.||:..||:|::|:..||.|:..:|:||:.|.|||.:||:|
Zfish   344 MKNRTAAKLYRRRKRDYVLGLETRITSIEDQNQKLKEELDNLKKL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
crembXP_021325839.1 Transposase_22 <7..244 CDD:308569 3/6 (50%)
bZIP_CREB1 338..390 CDD:269838 27/51 (53%)
coiled coil 339..390 CDD:269838 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407205at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.