DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and ATF1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_016874820.1 Gene:ATF1 / 466 HGNCID:783 Length:279 Species:Homo sapiens


Alignment Length:270 Identity:88/270 - (32%)
Similarity:112/270 - (41%) Gaps:98/270 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 STVIHTT--PGNAVQ------VRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRR 200
            ||...|.  ||:|||      :..::...        ..::..:||.:|:......|  ..|.||
Human    15 STTSETAPQPGSAVQGAHISHIAQQVSSL--------SESEESQDSSDSIGSSQKAH--GILARR 69

  Fly   201 PSYNKIFTEISGPDM---------SGASL--------------------------------PMSD 224
            |||.||..::|..|.         ||.|.                                |.:|
Human    70 PSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTD 134

  Fly   225 GVLNSQ-LAGTGAGGNAANSSLMQ----------LDP--------------TYYLSNRMSYN--- 261
            ||...| |..|.:|.....::::|          |.|              ||.:....|..   
Human   135 GVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLP 199

  Fly   262 -----------TNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALI 315
                       |:.:...:|...||||||.||||||||||||||||:|||||||||||||||.||
Human   200 QTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLI 264

  Fly   316 EELKSLKELY 325
            ||||:||:||
Human   265 EELKTLKDLY 274



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144417
Domainoid 1 1.000 100 1.000 Domainoid score I7018
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4360
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407205at33208
OrthoFinder 1 1.000 - - FOG0001658
OrthoInspector 1 1.000 - - otm40992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45879
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 1 1.000 - - X1385
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1010.120

Return to query results.
Submit another query.