DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Atf-2

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster


Alignment Length:306 Identity:69/306 - (22%)
Similarity:107/306 - (34%) Gaps:81/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NP-----QQQQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQ 106
            ||     ||..:...|.|...|....|:.:......|          ||::...     |.||..
  Fly    82 NPFDIGFQQAAERNVSGTPSRPEARPNDGESLHTPQV----------YPVEAPT-----VVSVPS 131

  Fly   107 AN--PSGVIQTAAGTQQQQQALA-AATAMQKVVYVAKPP-----NSTVIHTTPGNAVQV------ 157
            .|  |..|   :.|.....|.|| ..|:..|......||     ...:....|..:|.:      
  Fly   132 ENQVPQSV---SCGDMDVDQLLATTVTSPSKASQDGPPPLQLIQPQVLTWVLPAQSVPISIATVD 193

  Fly   158 --RNKIPPTFPCK--IKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGP--DMS 216
              ||::.||....  |.|:|..:                ..::.::||  ..|....:.|  :.|
  Fly   194 CNRNRVKPTGAIHPFILPKPTAK----------------ELNKTSKRP--EPILVSCNPPNNEPS 240

  Fly   217 GASL-PMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNT-NNSGIAEDQTRKREIRL 279
            .||| |.|...:..:|.......|                ||.|::| ..:..|:|::|..:. :
  Fly   241 SASLTPTSQLPIKERLKAIIHSNN----------------NRRSFSTPPKAAKAKDRSRDEDC-M 288

  Fly   280 QKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKSL-KEL 324
            ::.|.||...|.|.:...|.|..:.|.|:.:|:.|.|.:..| |||
  Fly   289 ERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKEL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 12/35 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.