DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Creb3l2

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001012188.1 Gene:Creb3l2 / 362339 RGDID:1306040 Length:521 Species:Rattus norvegicus


Alignment Length:265 Identity:58/265 - (21%)
Similarity:99/265 - (37%) Gaps:74/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PSGVIQTAAGTQQQQQALAAATAMQKVVYVAKP--PNSTVIHTTPGNAVQVRNKIPPTFPCKIK- 170
            ||..|:|...|::|...|..:..: .:..::.|  ...:.:..:.|.....:..||     ||| 
  Rat   121 PSATIKTEPITEEQPPGLVPSVTL-TITAISTPFEKEESPLDMSAGGDSSCQTLIP-----KIKL 179

  Fly   171 ------------------------PEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEIS 211
                                    |.|.:.|..||:.|||.:...|..|              :|
  Rat   180 EPHEVDQFLNFSPKEASVDQLHLPPTPPSSHSSDSEGSLSPNPRLHPFS--------------LS 230

  Fly   212 GPDMSGASLPMSDGVLNS--------QLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIA 268
            .....|.::|.....|::        :|.|:|............:...|.:..::....     :
  Rat   231 QAHSPGRAMPRGPSALSTSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTK-----S 290

  Fly   269 EDQTRKREIRLQKNREAARECRRKKKEYIKCLE--------------NRVAVLENQNKALIEELK 319
            |::..|:..|..||:.:|:|.|||||||:..||              .:|.||||.|:.|:::|:
  Rat   291 EEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQ 355

  Fly   320 SLKEL 324
            .|:.|
  Rat   356 KLQTL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Creb3l2NP_001012188.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..264 17/81 (21%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 296..325 15/28 (54%)
bZIP_CREB3 305..348 CDD:269837 16/42 (38%)
coiled coil 305..348 CDD:269837 16/42 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 336..357 8/20 (40%)
S1P recognition. /evidence=ECO:0000250|UniProtKB:Q70SY1 427..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.