DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Creb3l1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_038961358.1 Gene:Creb3l1 / 362165 RGDID:1359613 Length:606 Species:Rattus norvegicus


Alignment Length:258 Identity:67/258 - (25%)
Similarity:99/258 - (38%) Gaps:85/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QQQQA-------LAAATAMQKVVYVAKPP--------NSTVIHTTPGNAVQ--VRNKIPPTFPCK 168
            :|:|:       |||::||.... :|.||        ...:.|..||...|  |....||.....
  Rat   129 KQEQSPELPVDPLAASSAMAAAT-MATPPLLGLSPISRLPIPHQAPGEMTQLPVIKAEPPEMSQF 192

  Fly   169 IK----------PEPNTQHPEDSDESLSDDDSQHHRSELTRRP------SYNKIFTE--ISGP-D 214
            :|          |.|.:.|..||      |.||..||.....|      |...|.|.  ::.| .
  Rat   193 LKVTQEDLVQMPPTPPSSHGSDS------DGSQSPRSLPPSSPVRPMARSSTAISTSPLLTAPHK 251

  Fly   215 MSGASLPMSDGVLNSQ----LAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKR 275
            :.|.|.|:   :|..:    |...|                |.:..::....     ||::..||
  Rat   252 LQGTSGPL---LLTEEEKRTLIAEG----------------YPIPTKLPLTK-----AEEKALKR 292

  Fly   276 EIRLQKNREAARECRRKKKEYIKCLE--------------NRVAVLENQNKALIEELKSLKEL 324
            ..|..||:.:|:|.|||||||::|||              .:|..||..|:.|:::|:.|:.|
  Rat   293 VRRKIKNKISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Creb3l1XP_038961358.1 bZIP_CREB3 290..343 CDD:269837 20/52 (38%)
coiled coil 292..343 CDD:269837 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.