DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Atf6

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster


Alignment Length:203 Identity:45/203 - (22%)
Similarity:83/203 - (40%) Gaps:41/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 KPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYN 204
            :.||.. .::|..|...::|::|.|               ..|...:..::..:.|.||:....|
  Fly   155 RSPNKE-FNSTISNLSDIKNELPET---------------SQDLGFNSYNTSRNNSTLTKSWPIN 203

  Fly   205 KIFTEIS-GPDMSGASLPMS----------DGVL--------NSQLAGTGAGGNAANSSLMQLDP 250
               ||:: ...:....||:|          .|:|        .:...........:|..:.:.:.
  Fly   204 ---TELNLDNQVPKTVLPLSRTIYLPSHDYKGLLPTVKCNGDRTLKKNVNVRSKISNIVIKKKNA 265

  Fly   251 TYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALI 315
            |:..|.:.|   ..|...:|:..|:..|:.||||:|...|:|:|||:..||.|:..||.:..:|.
  Fly   266 TFIQSLKES---TPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLK 327

  Fly   316 EELKSLKE 323
            .|..:|::
  Fly   328 AENITLRD 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 19/49 (39%)
coiled coil 287..338 CDD:269848 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.