DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and creb3l1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_005169023.1 Gene:creb3l1 / 338317 ZFINID:ZDB-GENE-030219-181 Length:526 Species:Danio rerio


Alignment Length:239 Identity:63/239 - (26%)
Similarity:97/239 - (40%) Gaps:54/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LAAATAMQKVVYVAKPP---------------NST-VIHTTPGNAVQVRNKIPPTFPCKIKPEPN 174
            ||.::.....:.:|.||               ||. .|...|..|.|..| :|.....::.|.|.
Zfish   137 LANSSTCSPPLTLAPPPQRNHSGEKGSKGLSSNSVPAIKAEPREANQFLN-VPSEEHLRLPPTPP 200

  Fly   175 TQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLP--MSDGVLNSQLAGTGAG 237
            :.|..|||.|    .|.|....|:  |.:  :.:..|.|..|.|.|.  .|..:.:|.|......
Zfish   201 SSHGSDSDGS----QSPHSLPPLS--PGH--LQSPHSLPPSSPARLQARTSTAISSSPLLTAPHK 257

  Fly   238 GNAANSSLMQLDPT--------YYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKK 294
            ....:..||..:..        |.:.|::....     .|::..||..|..||:.:|:|.|||||
Zfish   258 LQGTSGPLMLTEEEKRTLIAEGYPVPNKLPLTK-----TEEKALKRVRRKIKNKISAQESRRKKK 317

  Fly   295 EYIKCLE--------------NRVAVLENQNKALIEELKSLKEL 324
            ||::|||              .:|..|||.|::|:::|:.|:.|
Zfish   318 EYVECLEKKVENYTSENNELWKKVETLENANRSLLQQLQRLQAL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
creb3l1XP_005169023.1 bZIP_CREB3 296..350 CDD:269837 22/53 (42%)
coiled coil 298..349 CDD:269837 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.