DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Atf1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001094365.1 Gene:Atf1 / 315305 RGDID:1307360 Length:268 Species:Rattus norvegicus


Alignment Length:267 Identity:91/267 - (34%)
Similarity:111/267 - (41%) Gaps:96/267 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 AKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSY 203
            |..|.|||    ||...|:.:::...        ..::..:||.:|:......|  ..|.|||||
  Rat    13 ASQPGSTV----PGIISQIVHQVSSL--------SESEESQDSSDSIGSSQKAH--GILARRPSY 63

  Fly   204 NKIFTEISGPDMSG---------------ASLP--------------MSDGVLNSQLAGTGAGGN 239
            .||..::|..|..|               .|:|              ..:|.|  |||..|..|.
  Rat    64 RKILKDLSSEDTRGRKGDGENPSISAVTSMSVPTPIYQTSSGQYIAIAPNGAL--QLASPGPDGV 126

  Fly   240 AA-------NSSLMQ----------------LDP--------------TYYLSNRMSYN------ 261
            .|       |||..|                |.|              ||.:....|..      
  Rat   127 QALQTLTMTNSSSAQQGAILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTM 191

  Fly   262 --------TNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEEL 318
                    |:.:...:|...||||||.||||||||||||||||:|||||||||||||||.|||||
  Rat   192 VMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEEL 256

  Fly   319 KSLKELY 325
            |:||:||
  Rat   257 KTLKDLY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Atf1NP_001094365.1 pKID 47..81 CDD:396650 12/35 (34%)
bZIP_CREB1 212..266 CDD:269838 47/52 (90%)
coiled coil 213..264 CDD:269838 46/51 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338127
Domainoid 1 1.000 100 1.000 Domainoid score I6843
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4265
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407205at33208
OrthoFinder 1 1.000 - - FOG0001658
OrthoInspector 1 1.000 - - otm45127
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45879
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1385
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.090

Return to query results.
Submit another query.