Sequence 1: | NP_001334685.1 | Gene: | CrebB / 32817 | FlyBaseID: | FBgn0265784 | Length: | 331 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094365.1 | Gene: | Atf1 / 315305 | RGDID: | 1307360 | Length: | 268 | Species: | Rattus norvegicus |
Alignment Length: | 267 | Identity: | 91/267 - (34%) |
---|---|---|---|
Similarity: | 111/267 - (41%) | Gaps: | 96/267 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 139 AKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSY 203
Fly 204 NKIFTEISGPDMSG---------------ASLP--------------MSDGVLNSQLAGTGAGGN 239
Fly 240 AA-------NSSLMQ----------------LDP--------------TYYLSNRMSYN------ 261
Fly 262 --------TNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEEL 318
Fly 319 KSLKELY 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CrebB | NP_001334685.1 | None | |||
Atf1 | NP_001094365.1 | pKID | 47..81 | CDD:396650 | 12/35 (34%) |
bZIP_CREB1 | 212..266 | CDD:269838 | 47/52 (90%) | ||
coiled coil | 213..264 | CDD:269838 | 46/51 (90%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166338127 | |
Domainoid | 1 | 1.000 | 100 | 1.000 | Domainoid score | I6843 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 152 | 1.000 | Inparanoid score | I4265 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D407205at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001658 | |
OrthoInspector | 1 | 1.000 | - | - | otm45127 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45879 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1385 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
10 | 10.090 |