DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Creb3l4

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001007094.1 Gene:Creb3l4 / 310616 RGDID:1359278 Length:367 Species:Rattus norvegicus


Alignment Length:257 Identity:56/257 - (21%)
Similarity:94/257 - (36%) Gaps:96/257 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQ-VRNKIPPTF-------- 165
            |||.:.......|   ..::.|:.:|||.|             .|:| .:.:..|||        
  Rat    65 SGVSEDPGSPAPQ---APSSPALYEVVYEA-------------GALQGTQREAGPTFGLISIQID 113

  Fly   166 ---PCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVL 227
               |..:.|...|         :||..|:.||..|               |.:|..:.|....:|
  Rat   114 QWSPAFMVPGACT---------VSDLPSEAHRHIL---------------PRVSTIAPPPPAALL 154

  Fly   228 NSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGI----------AEDQTRKREIRLQKN 282
            :.|                    ..:|::...:.....|:          ||::..|:..|..:|
  Rat   155 SCQ--------------------RLFLTDEEKHLLGQEGVTLPSHLPLTKAEERILKKIRRKIRN 199

  Fly   283 REAARECRRKKKEYIKCLENRVAV--------------LENQNKALIEELKSLKELYCQTKN 330
            :::|::.||:|||||..||:|||.              ||.||.:|:.::..|::...||.:
  Rat   200 KQSAQDSRRRKKEYIDGLESRVAACSEQNQKLQRKVQELERQNISLVAQVHQLQKFTAQTSS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Creb3l4NP_001007094.1 Required for transcriptional activation. /evidence=ECO:0000250 1..52
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..81 4/18 (22%)
bZIP_CREB3 190..250 CDD:269837 21/59 (36%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 191..230 16/38 (42%)
coiled coil 192..243 CDD:269837 18/50 (36%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 231..252 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.