DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Atf6

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001100666.1 Gene:Atf6 / 304962 RGDID:1305471 Length:656 Species:Rattus norvegicus


Alignment Length:240 Identity:54/240 - (22%)
Similarity:91/240 - (37%) Gaps:58/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 QHGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQVRNK 160
            :|||        .|...||.::....|.:.|....|.:.....:.|..:.:|.|           
  Rat   149 EHGL--------TPKKKIQMSSKPSVQPKPLLLPAAPKTPANASVPAKTIIIQT----------- 194

  Fly   161 IPPTFP-------CKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPD---- 214
            :|...|       ..|:|.|.                 ..::.|..:|:..::.|....|.    
  Rat   195 LPALMPLAKQQSIISIQPAPT-----------------KGQTVLLSQPAVVQLQTPGVLPSAQPV 242

  Fly   215 --MSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKREI 277
              ::|.:..:.:.|:|  :.......:..|..|....|....|.|    :..|.||   ..:|:.
  Rat   243 LAVTGGATQLPNHVVN--VVPAPVVNSPVNGKLCVTKPVLQSSTR----STGSDIA---VLRRQQ 298

  Fly   278 RLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKSLK 322
            |:.||||:|.:.|:|||||:..||.|:....::|:.|.:|..|||
  Rat   299 RMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGSLK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Atf6NP_001100666.1 Transcription activation. /evidence=ECO:0000305 1..137
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..171 7/29 (24%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 295..326 16/30 (53%)
bZIP_ATF6 296..347 CDD:269848 22/48 (46%)
coiled coil 296..347 CDD:269848 22/48 (46%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 335..342 2/6 (33%)
Interaction with THBS4. /evidence=ECO:0000250|UniProtKB:P18850 455..575
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..656
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.